Home 

Gene Symbol:  
SGR_4413
Organism:  
Streptomyces griseus subsp. griseus NBRC 13350
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5158608..5159654 [1], 1047 bp
Product Function:  
putative lantibiotic biosynthesis protein
Product Locus:  
 YP_001825925.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1047 bp
>SGR_4413|ThioFinder415 Streptomyces griseus subsp. griseus NBRC 13350
ATGACCCCCTCACCCGCACCGGCCGCGACCGCCGCCGGCACGTGGCAGGCCACCCACGTCTTCTACGCCG
CCAACCCCCGCCCCTTCCTCCTGAACTGCGTCCGCCCGCTGGTCGCGGAGCTGGAGGCCGACGGGCTGCT
CGCCGGGTACTTCTTCATCAACTACTGGCTGGAGGGCCCCCACGTACGGCTGCGCCTCAAGCCGTCCTCA
CCCGCCGCCGAGCCGGAGGTGGCCCGCCGCACCGAGGAGGCCGTGGACGCGTTCCTCGCCGAGCGGCCCG
CCCTGTACGAGGTCGACTCCGGGTTCCTCAACGACTTCTACAACGCCCTCTTCGAGATCGAGTTCCCCGG
CGGCGAGCGCGGCCACTACACCGACGAACAGGGCCGGATGAACCTGCGCCCCAACAACTCCCGCCACCGC
GAGCCCTACGAACCGGAGTTCGGGAAGTACGGCGGTCCCGCCGGGATCGAGCTGGCCGAGTGGCACTTCC
GGCACTCCAGCGATCTGGTGATCGACGCGCTCGCCACCAAGAACCTCCACCTGCGCACCGTCCTGCTGGG
CACGGCCGCCCAGTTCATGATGGTGATGGCCTCCACCTTCCTGCCGGACCGGGCGGAGCTGACCGGATAC
CTCGACGACTACTACGCTTTCTGGCACCGGGCGTTCCCCGGCACCGGATTCATCGGCACCGACGAGTACG
ACACCAACTACGCCCGGACGGCGGACGGGCTGCGGGACCGGTTCGCCCGGGTCCGGGCCGCCACCGCCCC
GCCCGGGAGCGCCCGCTCGCTCCCCGGGTCCCTGGCCGGCTGGGCCGAGCACTGCGCCGAACTGCGCGAC
CGGGCCCGGGGGCTGGCCGTGGACGGAGACCTGGTCTTCCGGTCCTGGGACGGCGAGCGGGACGAACGGG
TCACCGACCCCGCCGTGGCACTGCCGCTGCTGCTCTCCCCGTACATGCACATGACGAACAACCGGCTGCA
CGTCACCATCCGCGACGAGGCCTATCTCAGCCACGTCCTGGGCCGGGTCCTCAAGGAGTCCGCGTGA
 Primer design

Protein Sequence:348 a.a.
>SGR_4413|ThioFinder415 Streptomyces griseus subsp. griseus NBRC 13350
MTPSPAPAATAAGTWQATHVFYAANPRPFLLNCVRPLVAELEADGLLAGYFFINYWLEGPHVRLRLKPSS
PAAEPEVARRTEEAVDAFLAERPALYEVDSGFLNDFYNALFEIEFPGGERGHYTDEQGRMNLRPNNSRHR
EPYEPEFGKYGGPAGIELAEWHFRHSSDLVIDALATKNLHLRTVLLGTAAQFMMVMASTFLPDRAELTGY
LDDYYAFWHRAFPGTGFIGTDEYDTNYARTADGLRDRFARVRAATAPPGSARSLPGSLAGWAEHCAELRD
RARGLAVDGDLVFRSWDGERDERVTDPAVALPLLLSPYMHMTNNRLHVTIRDEAYLSHVLGRVLKESA