Home 

Gene Symbol:  
SGR_4412
Organism:  
Streptomyces griseus subsp. griseus NBRC 13350
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5155816..5158608 [1], 2793 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001825924.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2793 bp
>SGR_4412|ThioFinder414 Streptomyces griseus subsp. griseus NBRC 13350
ATGACCGAAACCACCGGGCCCGCCGGTACCGCCGAAACCACGGGGACCACCGGGACCGCCGACGCAGTCG
ACGCCGCTCGCAGCGGCACCGGCTCCCCCCGCCCCGCGTTCATGCTGCGCGTCGCCGGGCTCCCCGTCGA
CGACGTCCGGGCCCTGCGCTGCCCCGACAGCCGCCGCTGGGCCGACGACGTCCTCGACACCACCGAGCAA
CTGGCGCTGCTGGCCGGCAAGGCCGGGGACCAGCTGCACGGGCTGATCGGCGGCAGCGACGACGAACCGC
TGCGCCGCGCCCTGCTGAAGCTGCGCCGGGACGTCTTCAACAACCGGCTGCCGGACCCGGTGGCCGCGAA
GGACGCCCTCGCCCGGGTGGGCGCCCTCGACCCGGCCGCCGCCCGGGCCCTCGCCGACTGGCTGACCGGC
CGCCGCGCCCTCGCCGCGAAGCGCGAGGCGGGGGCCGGGCCGCTCGCCGCCGAGACCGGCCGCAGCCGCG
CCGAACTGGCCCGGATCGCCGGCCACGAGCGCCTGCGCAAGGGGCTGTTGCTCGCCTCGCCGACCCTGGA
CGCACAGCTCGACGCCTACCGGCGCCAGGCGTCCCGGGCCGGGGCCCGGCCCGACCGCAAACAGCGCAAG
ATCGAACGTTCGCTGCTCTCCTACGTCTACCGCACCGCCTGCAAGACCAGCCCCTTCTCCACCTTCACCG
CCGTCGCCCCCGGCGTGTTCGGCGGCTCGGACGGCCTGCGGGTCCGGGTCGGCGAGGAGTGGCGGACGCA
GGTCCGGCTCAACGTCGTGGCGCTCGGCCGGCTCGCCGACGCGGTGATCGCCGACCCGGTCCGCCGGGCC
GATCTGCCCCTCGCCCTCGCCTCCGGCTGGGGACGCGACGACGACCGGGTCCGCTACGTGCGGCGCTGGG
TCACCGCCGGGGACGACGACACCGCCGTCACCTTCGACGCGGTGAAGGACCGGCTGTTCTTCCTGCGCCG
CAGCGGCACCCTGGAACGGCTGCTCGGCCTGTTCGAGGAGCGCGGCACGATCCGCTACGGCGAGCTGGCG
GCCTGGCTGGAGCAGGACCGGGGCGCGGCGCGCGAGGAGTGCGAGCAGTACCTCGGGGCGCTCCTGGACG
TCGGCATGGTCCAGGTGCCGTGCCTGCGGACCGAGGTCCACGACACCGACCCGCTCCGCGCCTTCCAGGA
CGCGCTGCGCGGCCTGGACCGGCCCTGGGCCGACCGGCTCGCGGACCGGCTGGACGAACCCGCGGCCCGG
GCCGCCCGCTTCGCCGAAGCGGCCCCGGACGAGCGGCGCGCCCTGCTGGAGGCCGTGCGGGCCGGGCTGC
GGGCCGTCCAGGAGGAGGAGCTGGGGGCCGGGCGCGCGAAGGTGCCGCAGACCGTGCTGTACGAGGACGC
GGCGGCGGCGCCCCGCCGGGCGACCGGCACCGGCGTCGCGCTGGACCCCGAGGCCTGGGAGGAGCTGGCC
GCCGGCCCGCTGGCGGCCGTGGAGCGGGTCCTGCCCGCCTTCGACCTCACCCTTCCGCAGCGGATCACCT
TCCAGGGCTTCTTCCTCGCCCGGTACGGCCGCGGCGGGCGCTGCGACGACCTGCTGAAGCTGGTCCACGA
CTTCCACGAGGACTTCTTCGACCAGTACATGACGTTCACCGCCTCCCGCACCCCGTACGACGCCGACGGC
GCCTACGTCCCCGAGGTCAACTGGCTGGGCCTGGAGCGGCTGCGCGCCCTCGACACCGCCCGGCGCACCT
TCACCGCCCGGATGACCGCGCTGTGGGAGGCGGCCGAAGCGGCGGGACCCGGGGCGGCCGAGATACGTCT
CGACGACGCGTTCCTCGACGCGGTCGCCGAAGAACTCCCCGCCGTGGATGGCGAATTCACGCCGATGAGC
CATCACGTGCAGATCGCCGACCGGCCCGGCGACCCGCTCGTCGTCCTCAACCGCTCCTACGGCGGGGTGT
CGTTTTCGTTCACCCGGTTCACCCAGCTTTTCGACGGCCTCGGCGAACGGCTCCTCGCCGACACCGACGC
CCTGGTGCCCGAGGGCGCCGTCCTGGCCGAGGTCACCGGCGGTCCCGTCACCAGCAACCTCAACCTGCAC
GCCAGGCTCACCCCGTACGAGATCGTCTGCCCCGGCGAACGCGGCACCCTGGACGAGGAGTTCCGGATCG
CACTGGACGACCTGTACCTCGTGCACGACCCGGAGGCCGACCGGCTGGCCCTGCGCTCGGTCCGCCTGGA
CCGCGAGGTGATCCCCGTCTACCTCGGCTACCTCGTCCCCCTCGCCCTGCCCGAACTGCCCCGCACCCTG
CTCCTCCTCTCCCCGACCTCGATGGCCCCCCTCAACGTGTGGGCGGGCGTCCCCGAGGGCGAGCCGCGCG
GCGGGGTCACCGGGCGGCCCCGGGTGCGGCACGGCTCCCTCGTCCTGAGCCGGCGCAGCTGGAGCGCCCC
GGCGGCCGTCCTGCCGCTGCACCGGCCGGGCGCCCCGGAGGACGGCTGGTTCCTGGACTGGCACGCCTTC
CGGCGCACCCACGGTCTGCCCGACCGGGTCTTCGCGACCGTGTCGGACACCGGGGCCCGGGGCGCGACCG
GGGCCAAACCGCAGTACCTCGACTTCGACAGCCCGCTGTCCCTGTCCGCCTTCGAGGCGCTGGTCAAGTC
CGCCGACGCCCGCGTGGTGTTCCGGGAGATGCTGCCCGACGAGGACACGCTGCCCACCGTCAGCGGTCAC
GGCCGCCATGTCGCCGAACTGGCCGTGGAGACGGCCGTACCCGTCCGCAGGAGGACCACCTGA
 Primer design

Protein Sequence:930 a.a.
>SGR_4412|ThioFinder414 Streptomyces griseus subsp. griseus NBRC 13350
MTETTGPAGTAETTGTTGTADAVDAARSGTGSPRPAFMLRVAGLPVDDVRALRCPDSRRWADDVLDTTEQ
LALLAGKAGDQLHGLIGGSDDEPLRRALLKLRRDVFNNRLPDPVAAKDALARVGALDPAAARALADWLTG
RRALAAKREAGAGPLAAETGRSRAELARIAGHERLRKGLLLASPTLDAQLDAYRRQASRAGARPDRKQRK
IERSLLSYVYRTACKTSPFSTFTAVAPGVFGGSDGLRVRVGEEWRTQVRLNVVALGRLADAVIADPVRRA
DLPLALASGWGRDDDRVRYVRRWVTAGDDDTAVTFDAVKDRLFFLRRSGTLERLLGLFEERGTIRYGELA
AWLEQDRGAAREECEQYLGALLDVGMVQVPCLRTEVHDTDPLRAFQDALRGLDRPWADRLADRLDEPAAR
AARFAEAAPDERRALLEAVRAGLRAVQEEELGAGRAKVPQTVLYEDAAAAPRRATGTGVALDPEAWEELA
AGPLAAVERVLPAFDLTLPQRITFQGFFLARYGRGGRCDDLLKLVHDFHEDFFDQYMTFTASRTPYDADG
AYVPEVNWLGLERLRALDTARRTFTARMTALWEAAEAAGPGAAEIRLDDAFLDAVAEELPAVDGEFTPMS
HHVQIADRPGDPLVVLNRSYGGVSFSFTRFTQLFDGLGERLLADTDALVPEGAVLAEVTGGPVTSNLNLH
ARLTPYEIVCPGERGTLDEEFRIALDDLYLVHDPEADRLALRSVRLDREVIPVYLGYLVPLALPELPRTL
LLLSPTSMAPLNVWAGVPEGEPRGGVTGRPRVRHGSLVLSRRSWSAPAAVLPLHRPGAPEDGWFLDWHAF
RRTHGLPDRVFATVSDTGARGATGAKPQYLDFDSPLSLSAFEALVKSADARVVFREMLPDEDTLPTVSGH
GRHVAELAVETAVPVRRRTT