Home 

Gene Symbol:  
SGR_4411
Organism:  
Streptomyces griseus subsp. griseus NBRC 13350
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5154167..5155801 [1], 1635 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001825923.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1635 bp
>SGR_4411|ThioFinder413 Streptomyces griseus subsp. griseus NBRC 13350
ATGACCGCCTCTCCCCTCCACCCTCCTGCCGCGACCAAGGAGCTCGCCATGGGATACGCCCATGAATACG
CCGACGCGATCATGCATCGCGGCCGGGTCCCGATGGACCCCGCGGACTACGTACCGAACTGGCAGGACGG
CCCCCGCAAGGCCAAGTACCACCCGGGCGCGGACGGCTTCCCGCTGCCGGACGCGTCCTACCCGGCCGGG
GCGACGCTCGACCGGGGCCTGTTCCCCGAAGGGGGCCCGGCCGAGGGGGAGTTCGACCTCGTCGCGCTCT
CCGGCATGCTCCGCGACTCGTACGGTCTCACCGGCCGCCGCCTCGGCGTCCAGGCCAACACCGACCTGGA
CGCCCTGCCCTTCTACCCGCTGGCCAACTGGTCGCGCGGCTCCGCCTCCGGCGGCGGGCTGTACCCGGTC
GGCATCCACTGGGTGTCCGGGCCGAGCGGCCCCGTGCCGCCCGGGGTGCACTACTACTCCACCCGGCACC
ACTCCATGCAGCGGCTGCTCACCGGCGATGTCTCCGACCGGGTCCGCGCGGCGCTGGGGGAGGACGCCCC
GGGGCCGGAGACCGATCAGTACCTGGTGCTCTCCATCAAGTACTGGCAGAACTCCTTCAAGTACAACAGC
TTCTCCTTCCACGCCGTCTCCATGGACCTCGGGGCCTGCGTCCAGACCTGGCGGATGTGGGCCGCCGCCC
GGGGGCTGGCCGTCGAGCCGGCCCTCTGGTTCGACGAGGAACGCCTCGCGGAACTCCTCGGGGTGGACCC
CGAGGCGGAGGGGATCTTCGCGGTGGTCCCGCTCAAGTGGGCCGGTCCGCAGCCGCCTTCGGGGCGGCCC
GCCGCTGAGGGGCCCGTCGCCGTGCGCCGCGGGGACGTCGAGCGCTCCCGGACCGTCCTCACCTTCGACG
CGCTGGTCCGCATGCAGGCGGCCACATCGGCCGATGCCGCGGCCCGGCCCGGCCCGGGGGCGCTGGCCCC
GGCCGCCGCGCACCCCGTCGACCGGGCGCTCGCGGAGGTCGCGCTGCCGCCCGCGCGGGCGCTGGACGCG
GACGTACGCACCGCCCTGCGCGCGCGCCGCAGCAGCTTCGGCCGGTTCGACGCCCAGCGACCGGTCACCG
CCGACCAGTTGGCCGCCTGCCTGGCCGCCGCCTCGGCCGGATCGCGGATCGGCGGCGACACCGGGGACGT
CCGGCTGACCCGGCTCTACGCGTTCGTGAACCACGTCGAGGGCGTCGAGCCCGGCTCGTACGCCTACGAC
CCCGAGCGGCGCGGTCTGCGGCGGGTGAAGGAGGGGCGGCCGGGGGAGTTCCTCCAGCGGAACTACTTCC
TCTCCAACTACAACCTGGAGCAGGCCGGAGCGGTCCTGGTGCCGACCGTCCGCACCACCGCCGTCCTCGA
CGCGGTCGGGGACCGGGGATACCGGCTGGTCAACGCCACCATCGGGGCCGTCGCCCAGTCCGTCTACACC
GCCGCCGCGGCCATGGACCTGGGCTGCGGCGTCGCCCTCGGCTTCGACAACATCTCCTACATCGAGGAGC
TGGGTCTCGAAGGGACGGGCGAGGCGCCCCTGCTGATCATGATGATCGGCAACGAACGCCCCGCCCCCGC
CGACTTCCGCTACGAGATCGCCTGA
 Primer design

Protein Sequence:544 a.a.
>SGR_4411|ThioFinder413 Streptomyces griseus subsp. griseus NBRC 13350
MTASPLHPPAATKELAMGYAHEYADAIMHRGRVPMDPADYVPNWQDGPRKAKYHPGADGFPLPDASYPAG
ATLDRGLFPEGGPAEGEFDLVALSGMLRDSYGLTGRRLGVQANTDLDALPFYPLANWSRGSASGGGLYPV
GIHWVSGPSGPVPPGVHYYSTRHHSMQRLLTGDVSDRVRAALGEDAPGPETDQYLVLSIKYWQNSFKYNS
FSFHAVSMDLGACVQTWRMWAAARGLAVEPALWFDEERLAELLGVDPEAEGIFAVVPLKWAGPQPPSGRP
AAEGPVAVRRGDVERSRTVLTFDALVRMQAATSADAAARPGPGALAPAAAHPVDRALAEVALPPARALDA
DVRTALRARRSSFGRFDAQRPVTADQLAACLAAASAGSRIGGDTGDVRLTRLYAFVNHVEGVEPGSYAYD
PERRGLRRVKEGRPGEFLQRNYFLSNYNLEQAGAVLVPTVRTTAVLDAVGDRGYRLVNATIGAVAQSVYT
AAAAMDLGCGVALGFDNISYIEELGLEGTGEAPLLIMMIGNERPAPADFRYEIA