Home 

Gene Symbol:  
SGR_4410
Organism:  
Streptomyces griseus subsp. griseus NBRC 13350
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5152038..5154170 [1], 2133 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001825922.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2133 bp
>SGR_4410|ThioFinder412 Streptomyces griseus subsp. griseus NBRC 13350
ATGCCCGTTGAGACCGCGCCGGACACGGCGGCCCCCGCGCCGGACACGGCCCCCACGCCGGACGCCGCGG
GCACGTCGTACGCCCCGGTGGCTGCCGGTACCGCGCCGGGCGCGCCGGTGCTCGGGGAGTCCACCCGGCT
GCTCGCACGGCTGCTGGGGGAGGCCCTCGCCCGTCACGGCCGTGCGGCGGCCACCACCCCGCTGGACGTC
CGGCCCCTGGGCGTCCGCGACGCGTTCGCGACGGAAGGGCCGCCGGACGGAGCGGTGGAGTGGCCGCCGG
ACGGGGCGGTGGACGGAGCGGTGGGGTGGCCCGCGGACGGGCCGGTGGAGGGACCCGGGGGCCGGGCCGT
CCCCGTGCGCTACTACGGGCGGCACGCCGTCGTCGGTCCCCTCCCGGTCCCCGACGGCGCCCCCCGACGC
CCCTGCGCCCGCTGCCTGGAGCGCCGGTGGCAGGGCGTGCGGTCCGTCGCCCTGCGCGAGGCGCTGGAGC
TCGGTTCCGGGACCCGGGCGGCGGGCCCGTCCCCCTACCTCACGCCCTTCGCGGCCGAGGCCCTCGCCGG
AGTCGTCGCCGCCCGGCTGGACGGCGGCGGACCGGTCACCGGCGCGTTCCCGGCCGTCCACCTCGTCGAC
CTCGACACCCTGGCCGTACGCCACTACCCGCTCGTCCCCGACCCGGAGTGCCCCGCCTGCGGGCAGCCCG
AGCCGGACAGCGACGAGGCGGCTGCCCTCACCCTGCGGCCCGCGCCCAAGCTGCGGCCCGGTGGCTTCCG
GGTGCGGGACATCGAGGAGTACGAGCTGCCCGTCGAGCCGTACGCCAACCCCGTGTGCGGCTCCCTCGGC
CCCTCCGTCGTCCAGGACGTCTCCTCCACGTCCACCTCCGCCACCATCGGCTGCTTCTCCATGCGCTCGG
GACCGTATCTGCGCGAGACGTTCTGGGGCGGGCACGCCGACACGTTCGCCGAGAGCGTCCGCATCGGGGT
GCTGGAGGGACTGGAGCGGTACGCGGGCATGCGGTCCCGCGCCAAACGCGCCCAGGTGCACGCCAGTCTG
CACGCGCTGCGCGCCGAGGGCCGGGCCGTCGTGGACCCCCGCGTCAGCGGCCTGTACTCCGACGCCTTCC
ACCGGGCCAACCCCCGCGTCCGGCCCTTCACCCCCGACCGGGAGATCCCCTGGGTGCGCGGCTGGTCGCT
CCGCGACTCCCGCACCGTCCTGGTCCCCGAAGTGCTCACCTACTACCACGCGCCGGGCCTGGAGAACCGG
TTCGTGCAGGAGAGCTCCAACGGCTGCGCCTCCGGGGGAGCGCTGGAGGAGGCCGCCTACTTCGGGCTGA
TGGAGATCGTCGAACGGGACGCGTTCCTGCTCTCCTGGTACGGGCGGGCCGCGCTGCCCGAGATCGACCC
GCGCACCAGCCGCCGCCGCGCCACCCGGGAGATGGTGGACCGGCTGGAGATGTACGGGTACGAGGCGCGG
TTCTTCGACACCCGGATCTCCTTCCCGATCCCCGTCGTCACCGGCGTCGCCGTCCGCCCCGACGGCGGAC
GGGGCCGGATGTGCTTCGGGGCGGGCGCCGGACTCGACCCGGAGGCGGCCCTCGCCGGGGCGCTCTGCGA
GATCGCCACCGACGCCGTCAACCTCCAGGGCCGCACCGAGCGGGACGAGGAGCGGCTGCGGGCCATGGCG
ACCGACTTCGCGAAGGTCGAGGCGCTGCACGACCACCCGCTGGCGTACGGGATCCCGGAGATGGGCGACC
ACGCGGAGTTCCTGCTCGGCGCGCCGGGCAGCCCCCGACCGCCGCTGCGCTCCTTCGACGACCTGTACGG
GGACGGGCCCGACGCGCGGCCGGTGCTCCCGGTCTCCGACGATCTGCGCGAGGACCTGCTGCGGTGCGTG
GACACCGTCGCCGCCGCCGGGTTCGACGTGGTCGTCGTCGACCAGACCATGCCGGAACAGCGTGACCTGG
GGCTGCGGACGGTGAGCGTGATCGTGCCCGGACTGCTCCCGATCGACTTCGGCTGGACCCGCCAGCGCGC
CCTGCGGATGCCCCGGTTGCGCACCGCCCTGCGCGAGGCGGGCCTGCGGACGGCGGACCTCACCGACGCC
GACCTCAACCCGGCCCCGCACCCGTTCCCATGA
 Primer design

Protein Sequence:710 a.a.
>SGR_4410|ThioFinder412 Streptomyces griseus subsp. griseus NBRC 13350
MPVETAPDTAAPAPDTAPTPDAAGTSYAPVAAGTAPGAPVLGESTRLLARLLGEALARHGRAAATTPLDV
RPLGVRDAFATEGPPDGAVEWPPDGAVDGAVGWPADGPVEGPGGRAVPVRYYGRHAVVGPLPVPDGAPRR
PCARCLERRWQGVRSVALREALELGSGTRAAGPSPYLTPFAAEALAGVVAARLDGGGPVTGAFPAVHLVD
LDTLAVRHYPLVPDPECPACGQPEPDSDEAAALTLRPAPKLRPGGFRVRDIEEYELPVEPYANPVCGSLG
PSVVQDVSSTSTSATIGCFSMRSGPYLRETFWGGHADTFAESVRIGVLEGLERYAGMRSRAKRAQVHASL
HALRAEGRAVVDPRVSGLYSDAFHRANPRVRPFTPDREIPWVRGWSLRDSRTVLVPEVLTYYHAPGLENR
FVQESSNGCASGGALEEAAYFGLMEIVERDAFLLSWYGRAALPEIDPRTSRRRATREMVDRLEMYGYEAR
FFDTRISFPIPVVTGVAVRPDGGRGRMCFGAGAGLDPEAALAGALCEIATDAVNLQGRTERDEERLRAMA
TDFAKVEALHDHPLAYGIPEMGDHAEFLLGAPGSPRPPLRSFDDLYGDGPDARPVLPVSDDLREDLLRCV
DTVAAAGFDVVVVDQTMPEQRDLGLRTVSVIVPGLLPIDFGWTRQRALRMPRLRTALREAGLRTADLTDA
DLNPAPHPFP