Home 

Gene Symbol:  
SGR_4409
Organism:  
Streptomyces griseus subsp. griseus NBRC 13350
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5149733..5152048 [1], 2316 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001825921.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2316 bp
>SGR_4409|ThioFinder411 Streptomyces griseus subsp. griseus NBRC 13350
ATGGCCGAGAGCGCCGCACCCACCGCACCCGCCACGCCCCCCTCGACGACCGCACCCGGGTCGTCCCCCG
CGTCCCCCGCGTTCGACGCGCTCGCCGGGACCCGGCCGCGCGTCCGGCGCGACGTGCTGTTCACCGAGAC
CCCCGGCGGAGTGCTGTTCCACAACGCCGACGGCGGTTTCCACCTCACCGGCCGCACCGCCTACCGCTTC
GCCTCCCTCGTCGTCCCGCACCTCACCGGGCGCCACCGGCTGGCCGAACTCTGCGCCGGATTCGGGCCCG
CGCAGCGGGCGATGGCCGCCGAACTGGTCAAGACGCTGTACGCGCGCGGCTTCGCCCGCGACATCCCCGA
GGCCGATCCCGCCGGAGACACCCTCGACGAGGAGACCGCGGAGCGGTTCGCGGCGCAGATCGCCTACGTC
GACCACTACGCCGACGACGCCCCCGCCCGCTTCGCCCGCTACCGGGCCACCCGCGTCGCCGTCCTCGGCG
ACGACGAGACGGCCCGCTGGTGCGCGCTGAGCCTGGTGCGCAACGGCTGCGCGGACATCGGCACCGTCAC
GGCGGCGGAGGGCACGGCCGCCCCGCGGGACGACGAGCCCCCGCAGGACGGCGCCGCCGCGCCGGACGTC
GCCGCCGAGGCCGCCGCCCACGGGACGCGCATCGGGACGATCACCGCCGGGACGGACGCGGGCTGGGCCG
ACCTGGACGGCTACGACGTCGTCGTGGTCACCGGCGCGGACGCCGGGGCGCGCACCCACCGGCTGCTGGC
CGCCGGGGTGCCCGAGGGCGTGACCCTGATCCCCGCCTGGCCGTTCGGCCGCCGCCTGGTCGTCGGCCCG
CTCGCCACGGCCCGCTCCACCGGCTGCTGGTCCTGCGCCCTGCTGCGGCTGGGCGGCAACGTCGACCCCG
GCACGGCCGCCGAGCTGTGGAGCGAGGCGGCCGGGGCCGTACCCGCCGCCGGGGCGGCCCTGTCCGGTCC
GGTCGCCGCGATGGTCGGCAACCTCGTCGGCTACGAGGTCTTCCGCCTGGCCACCGGCGCGCTGCCCGCC
GAGACGGCCGGCCGGCTCCTCGTCCAGGACCTGGAATCGCTGGACGTGATGGCCGAACCGGTCCAGCCCC
ACCCCCGGTGCGCCCGCTGCACCCTGCTCGCCGCCGGCGAACCCGCGGGAGAGTCCGCCGCCGAACCCGC
CGCGCTGCCCGGCCCGCTCGCGCTGCCCGTCACCGCGACCGTGGAGACCGCCCGCGACGCGGAGGAGCTG
GTCGAGGAGCTGAACCGGATCAGCACCGCGCTGGTCCGCCCGTACACGGGGATCTTCCGCCGGTACGACG
ACGAGGAGCTGACCCAGACCCCGTTGAAGCTCAGCCGGGTCGAGGTGGCGCTCGGCGGCGGGAGGAGCCG
CCGCATCGCCGCGTTCGACGTGCACCACCTGGCCGGGGCGCGGACGCGGGCGCTGTACGCGGCGGCCGAG
GCGTACGTCGAGCACGTGGTCCCCCTGACGGGGGTGGAGAGCGGCGGGCCGGACGGCGGTGCGCGGACGC
TCGGGCCCGACGCCCTGACGACCGGCGGTGGCACCGGGACCGTCCCCGCAGCCTGGGCGGTCGCCACCTC
GCTGATCGGCAAGGACCCGGTCCGTGTCCCGGCCGCCGCACTGCGCCCGTTCGGGCCGCACAACCACGAC
CGGGCGCACCTGGCGACCACCGCCGGCTCCGGAGCGGGCGGCAGCGCGGCGGAGGCGGCGGGCCGGGGGC
TGCTGTCCGCCCTCGCCCACGACGCCCTGCTCCGCGCGGTGCGGGGCGCCACCCGGGTCGGCCCGCTGGC
GGTGGGCGGCGACGATCCGGAGCTGGTGTTCCTGCTGAAGTCCGCCGCCAACCTGGACATCGCCGTGGAC
CTCCTCGACCTGGGCGAGGCGGACCGCACCACCGCGCACGTGGTGCTCGCCCGGGAGGCGAACGGGCCCT
CCGCCGCGCCCCGTTGGGCGGTCGGGGCCGGGCTGTCCGGGCGGGCGGCGGCGGCGTCCGCCCTGCGCGA
CCTGCTCGGTCAGGCGCAGCTCGCGGCCGAGGACCCGGGGGAGGCGGTCGACACCGGGGACCCGCTGGTG
GTCGACCTGGCCCCCGGGGCGATCGCGGTGGGCGGCGGGTCCGTCGCGGCGGACGCGGCGGAGACCACGT
TCGACGCGGTGCTGGAGGCCCTGAGGTCCGCCGGCCGCGACGCCCTGTACGTGCCGACGACCCCGGCGGA
CCTGCGCTCCGGCTCCATCGCCACGGCCCGGGTGCTGCTCACGGTGGACGGCGAGGTCGGCACCGATGCC
CGTTGA
 Primer design

Protein Sequence:771 a.a.
>SGR_4409|ThioFinder411 Streptomyces griseus subsp. griseus NBRC 13350
MAESAAPTAPATPPSTTAPGSSPASPAFDALAGTRPRVRRDVLFTETPGGVLFHNADGGFHLTGRTAYRF
ASLVVPHLTGRHRLAELCAGFGPAQRAMAAELVKTLYARGFARDIPEADPAGDTLDEETAERFAAQIAYV
DHYADDAPARFARYRATRVAVLGDDETARWCALSLVRNGCADIGTVTAAEGTAAPRDDEPPQDGAAAPDV
AAEAAAHGTRIGTITAGTDAGWADLDGYDVVVVTGADAGARTHRLLAAGVPEGVTLIPAWPFGRRLVVGP
LATARSTGCWSCALLRLGGNVDPGTAAELWSEAAGAVPAAGAALSGPVAAMVGNLVGYEVFRLATGALPA
ETAGRLLVQDLESLDVMAEPVQPHPRCARCTLLAAGEPAGESAAEPAALPGPLALPVTATVETARDAEEL
VEELNRISTALVRPYTGIFRRYDDEELTQTPLKLSRVEVALGGGRSRRIAAFDVHHLAGARTRALYAAAE
AYVEHVVPLTGVESGGPDGGARTLGPDALTTGGGTGTVPAAWAVATSLIGKDPVRVPAAALRPFGPHNHD
RAHLATTAGSGAGGSAAEAAGRGLLSALAHDALLRAVRGATRVGPLAVGGDDPELVFLLKSAANLDIAVD
LLDLGEADRTTAHVVLAREANGPSAAPRWAVGAGLSGRAAAASALRDLLGQAQLAAEDPGEAVDTGDPLV
VDLAPGAIAVGGGSVAADAAETTFDAVLEALRSAGRDALYVPTTPADLRSGSIATARVLLTVDGEVGTDA
R