Home 

Gene Symbol:  
Tbis_0551
Organism:  
Thermobispora bispora DSM 43833
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
612661..613557 [1], 897 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003651171.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:897 bp
>Tbis_0551|ThioFinder435 Thermobispora bispora DSM 43833
ATGACGCCGCATGAAGCCGAAGTGATCTGGGTGAGCGCCCACATATTCCATCAAGGCCCGCTCGATCGGC
TCGTCACCGAGGTGGCCGGTCCGCTCTTCGTTGAGCTGGCGGCCGCCGGGCTGAGCACCCAGGGCTTCTT
CTTGCGCTACTGGGAGGGCGGCCCGCACCTCCGGTTCCGGGTCCGGCTGCTTCCCGGGGCGGATGCCGCC
GAGACCCGCCGGCTGATCAGGGAACGCGCCTGCGCTTACCTGCGGCGGTATCCGTCGCAGGATGTCCTCG
ATCGCGAGGAGTACGCCAGGCTGGCGGAGGTGCTCGCCGCCCGGGAGGGGCTGACCGGCCACGCCCGTGA
GCTCTATCCGAACGACTCGGTGCAGTTCATTTCCTACCGGCCGGAACACCACAGATACGGCCGCGGACCA
TCGCTCGAGGCCGTGGAACGGCATTTCGCGGAGTCCAGCCGGATCGCGCTGGAGCTGCTCCACGCCGGGC
TGACGATCCCGCAGCGAGGGGCGGTATGGCTGACCATGCTCATGGCCACCTGGCTGCTCGCGGGCTCACG
AGGCGAGGACGCGTTCCGCCCGTGGCCGGACGCCCGCAAAGAGCAGGCGTTCGACCGTGAGCGGGAACGG
TTGACCGGCCTTGCCCGGCATGCCCGGCAGCTCACCCTGCGGCCGCCGGATCCGGAGGCGCAGGGCGTGC
TAGCGGCGTGGCACGGTTCCGTGGCCCGGCTCGCCGACGCGCTGGCCGCGTCCGGCTTCACCGCGACGCG
GACCGCGACCGTGCTGGACCTGTGCGCGCACCTGCTCGCCAACCGTCTGGGCATCCGGATCCAGGACGAG
GCGAGGCTGCGCTATCTGGCGTCCCGGGCGCTCGATGAGGCGGAGGTGACCGTGTGA
 Primer design

Protein Sequence:298 a.a.
>Tbis_0551|ThioFinder435 Thermobispora bispora DSM 43833
MTPHEAEVIWVSAHIFHQGPLDRLVTEVAGPLFVELAAAGLSTQGFFLRYWEGGPHLRFRVRLLPGADAA
ETRRLIRERACAYLRRYPSQDVLDREEYARLAEVLAAREGLTGHARELYPNDSVQFISYRPEHHRYGRGP
SLEAVERHFAESSRIALELLHAGLTIPQRGAVWLTMLMATWLLAGSRGEDAFRPWPDARKEQAFDRERER
LTGLARHARQLTLRPPDPEAQGVLAAWHGSVARLADALAASGFTATRTATVLDLCAHLLANRLGIRIQDE
ARLRYLASRALDEAEVTV