Home 

Gene Symbol:  
Tbis_0553
Organism:  
Thermobispora bispora DSM 43833
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
614630..616006 [1], 1377 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003651173.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1377 bp
>Tbis_0553|ThioFinder437 Thermobispora bispora DSM 43833
ATGACCATCCCCCCAGGGCTCACGGAGCGGTATGCGCTGCGGGCGGGCGTGCACAGCGCCGTGCTGCCGG
ACGGCGTGATGCGGCTGTTCGCCTGGCCCCACGCTGAGTCGATCGGCGCCCTCAGCGCGGATGAGACCAC
GCTGCTGAAGGAGCTGGCGGAAGGACCGCGGGAGATCGCCGATCCCGCGCTGCGGCCTTTCGTGGAGCGG
TTGTTCCGGGGCGGCTGGCTCAAGCGGACCCTCAGCCGGGGAGAACACGACCTGTACACGCTCGATCCGC
TGCGCCGACCGGGATCGCGGCCCGCCCCACCCGACGATCCGGTGCTCTCCCGGTTCGCCGCAGTACGCCG
GCGTCCGTCCGGGTTCGTCATTGAATCGCCATTGGCCTGGTGCGACGTGCACGTCCACGACCCCGCGCTG
CTGCCTGACCTACTCGAGCCGGCAGGCGGGCGGGCGGGCCGGTCCTCGCTGGCCCCGCAGATCCGCCGCC
AGGCGCTTGCGGACCTTGCATGGGCGGGCCTGGTCGTACCCCGGGGCGCGGAGGACGGCGCTCTGCGGAC
CCGGCAGTGGGCGCCGCACGAGCTCGACTTCCATCAGCGCAGCAGGCTCTACCACCGGGGCTACCTGGGT
GACGGGTTCGGCGGCACGTTCTGGGCTCGGGGCACCTTCGACCCGCCCCAGGCTCGGCCGCAGCGGTATC
CCGGGGATCCGATCCCGCTCCACCGGCCGGATCTGAACGCGTTACGCGCGGCCGATCCACCGCTCACCGC
GGTCCTCGAGGACCGCCGGTCGGTGCGGGAGTACGACGACGACGCCCCCATGACCGTGGAGCAGCTCGGG
GAGCTGCTGTACCGGTCGGCCAGGATCCGGGACGTCAAGGTGATCGATGGCGTGGAGTACGTCAGAAAGC
CGTACCCGTCCGGTGGCTCCGTCTACGAGCTGGAAATCTACCCGGTGGTGCGGCACGTGGCCGGTCTGGC
GCCCGGCATGTACCACTACGACGCCTACGAGCATGTGCTCCGGCCGGTCCGCCCGGCCGGCCACCCAGCG
GTGCGCCGGATGCTCACCGTGGCATCGCACGGATCCGCGGTCGGCATCCGCCCGCAGCTCCTGCTCGTCG
TGTCCGCCCGGGTCGGCCGGGTGATGTGGAAGTACGAGGGCATGGGTTATGCCCTGATCCTCAAACACGT
GGGCGTGCTGTACCAGACGCTGTACTGCGTGGCGACCGCGATGGGACTCGCCCCGTGCGCCATCGGCAGC
GGCGACTCCGCCGCCTTCAGCGAGGCGACCGGGCGTGACCCGCTGGAGGAGTGCGCGGTGGGCGACTTCC
TCCTCGGTAGCCGTCCGGCATCCGGCTCCACCGTGGAGGAATCGTGA
 Primer design

Protein Sequence:458 a.a.
>Tbis_0553|ThioFinder437 Thermobispora bispora DSM 43833
MTIPPGLTERYALRAGVHSAVLPDGVMRLFAWPHAESIGALSADETTLLKELAEGPREIADPALRPFVER
LFRGGWLKRTLSRGEHDLYTLDPLRRPGSRPAPPDDPVLSRFAAVRRRPSGFVIESPLAWCDVHVHDPAL
LPDLLEPAGGRAGRSSLAPQIRRQALADLAWAGLVVPRGAEDGALRTRQWAPHELDFHQRSRLYHRGYLG
DGFGGTFWARGTFDPPQARPQRYPGDPIPLHRPDLNALRAADPPLTAVLEDRRSVREYDDDAPMTVEQLG
ELLYRSARIRDVKVIDGVEYVRKPYPSGGSVYELEIYPVVRHVAGLAPGMYHYDAYEHVLRPVRPAGHPA
VRRMLTVASHGSAVGIRPQLLLVVSARVGRVMWKYEGMGYALILKHVGVLYQTLYCVATAMGLAPCAIGS
GDSAAFSEATGRDPLEECAVGDFLLGSRPASGSTVEES