Home 

Gene Symbol:  
Tbis_0555
Organism:  
Thermobispora bispora DSM 43833
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
617879..619852 [1], 1974 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003651175.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1974 bp
>Tbis_0555|ThioFinder439 Thermobispora bispora DSM 43833
ATGTCTGATGCCCTGGCCGCGGCGATCATCGGGGCCGGCCTGCTCGCCGATGAGCTCGCCGCCGCGTTCC
GGCCGTACGGCGAGGTGATCAGGCTGGACGAGGTGGAGCGGGCCGAAACGGAGGCGCACCGGTTGCGGGC
GCTCGTGATGGCGTGCGACGGATGGGATACCTCTATTTATAGGGAGACCCGCGAACGCTGCCGGAGGCTC
GGCATCCCGTGGCTGCCCGTCCGGACCGAACACGGGATTGCCGTGATCGGCCCGCTCGAACGGCCCGGGG
AGCCCGGGTGCGCGCACTGCTTCGAGCTGCGCAGGGAACGGGCGCGCCCTGACGCGGCGGCCTACCGGGC
GATTCTCAACCACCACGGACCGGAGCTCGCCAAGCGGCCGTCGCCCTATCTCGACGAGCTGGCGGCCGCA
ACCATCGCGGCGCTGGGCGTACGGATGATCGATCAAGGCTCCGGGTGTCACGTCTGGTACGTGAGGCTCA
ACGGTCTGACCGTGGAACGCCACGCCTTCCTGCCCGAGCCCCTCTGCCCTGAATGCGGGTCACTGCCGAT
GGACGATCGGGACTCGGCGGTGATCGTCCTTCGGTCCCAGCCGAAGCGCGCCCCGGACGACTACCGCACC
AGGGACATCGTCGATGAGCTCGACGCGCTCGTGGCGGATTACGTCGACGGCGAGTCGGGATTGATCCGGC
CGCTGGTCCGCGACACGCAGGGCGGCCTGGTGATAGCCGGGGCGATGCTGCCGTTGCGGTTCGCCGGCGG
CTCGGAGCCAGGGGTCGGCCGGACCCGCGGCTACCGCACCAGCGAGGTGACCGCCATCTTGGAGGCGCTG
GAGCGGTGGGGCGGGGTCGAGCCCGGAGGCAAGCGCACCGTAATCCGGGCGGCCTTCCGCGACATCGCCG
CGGACGCGCTCGACCCGCGGACGCTCGGCGTGCATTCCCCCGAGGCCTACGCGGCCGAGGATTTCCCGTT
CCGGCCCTTCACCGAGGACGAGGAGACCGAGTGGGTCTGGGGATACTCCTTCGCCCGTCGTTCCCCGATC
CTCGTCCCGGAGACGGTGGCCTATTACTACGTGCACCGCGACCGGCCACGACAGGAGCGGCCGTTCCTGT
ACGAGATCTCCAACGGATGTGCACTGGGCAGCGGCATGGAGGAGGCGATCCTCTACGGGATCCTGGAGGT
CGTGGAGCGCGACGCCTTTCTCATGACCTGGTACGGCCGGCTCGGTGTGCCACGGATCGATCTCGATTCG
GCGAAGAACAGGATGGTCCCGCTGCAGGCCGCCGCGATCAGCGCGGAAACCGGCTACCGGATCGAGGTCT
ACGACACCACGATGGAGCACGGGATCCCATCGGTGTGGGCGCTCGCGATACGAGGCGGCGAGGAGCCCAC
GGCGGCCCCGCGGCCGCGCATGGTGTGCGCGGCCGCGGCTCACCTCGATCCCGAGCAGGCGGTGCTCAGC
GCACTCAGCGAACTGGGACCACTGCTCGCCGACTTGCTTCGCCGTTACCCCGACGAGGCCGAGCGGGCCC
GGCGCATGGTGGACGACCCCGGCCTCGTCACCACGATGCACGACCACTCGACCCTGTACGGCGCCGACGA
GGCGTTCGGCCGGCTCGAGTTCCTCACCGGCACGGCCTCGACCAGGGATCTCGCCGCCATGCGGGAGTCC
ACCGTGGCGTTCCGGTCGGCGGACCTCCGTGACGATCTCCTCGAGGTGATCGGCCGCATCCTGGCCGAGG
GAATGGACGTCATAGTCGTCGACCAGACCACTCCCGAGCACCGGGTGCACGGCTTCACCTGCGTCAAGGT
CCTGATCCCCGGGATGATCCCCATGACCTTCGGCCACCGTAATCGCAGGCTCGACGGCCTCACCCGGCCG
CTGGTGATCCCGTACCGGCTCGGGTATCGCCCGGCGCCGCTCACCCCCGAGGCGCTCAATCCGCACCCGC
ACCCTTTCCCGTGA
 Primer design

Protein Sequence:657 a.a.
>Tbis_0555|ThioFinder439 Thermobispora bispora DSM 43833
MSDALAAAIIGAGLLADELAAAFRPYGEVIRLDEVERAETEAHRLRALVMACDGWDTSIYRETRERCRRL
GIPWLPVRTEHGIAVIGPLERPGEPGCAHCFELRRERARPDAAAYRAILNHHGPELAKRPSPYLDELAAA
TIAALGVRMIDQGSGCHVWYVRLNGLTVERHAFLPEPLCPECGSLPMDDRDSAVIVLRSQPKRAPDDYRT
RDIVDELDALVADYVDGESGLIRPLVRDTQGGLVIAGAMLPLRFAGGSEPGVGRTRGYRTSEVTAILEAL
ERWGGVEPGGKRTVIRAAFRDIAADALDPRTLGVHSPEAYAAEDFPFRPFTEDEETEWVWGYSFARRSPI
LVPETVAYYYVHRDRPRQERPFLYEISNGCALGSGMEEAILYGILEVVERDAFLMTWYGRLGVPRIDLDS
AKNRMVPLQAAAISAETGYRIEVYDTTMEHGIPSVWALAIRGGEEPTAAPRPRMVCAAAAHLDPEQAVLS
ALSELGPLLADLLRRYPDEAERARRMVDDPGLVTTMHDHSTLYGADEAFGRLEFLTGTASTRDLAAMRES
TVAFRSADLRDDLLEVIGRILAEGMDVIVVDQTTPEHRVHGFTCVKVLIPGMIPMTFGHRNRRLDGLTRP
LVIPYRLGYRPAPLTPEALNPHPHPFP