Home 

Gene Symbol:  
Tbis_0554
Organism:  
Thermobispora bispora DSM 43833
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
616003..617886 [1], 1884 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003651174.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1884 bp
>Tbis_0554|ThioFinder438 Thermobispora bispora DSM 43833
GTGATCCCGGCGCGGCCCGTGCTGACCCCCGGCGTCCGGTACGCGCCGACCTCGGACGGGGTGGCATTCC
TCACCCGCGACGGCATCGTGTCGATCACCGGAGTCTCGATCCACCGGTGGATCGACCGGATCGCCCCGCA
TTTGACCGGTGAGCGGAGCGTGGCGGAGCTGACGGACGGGCTGGCACCGGAGCGCAGGGCCTTCGTGCTC
CGCCTGCTCCAGGCGCTGGCCGATCGCGGCCTGATCATCGACGCCGCGGGCGGCCGGGAGCCACGCCTCG
AGCGTGGCACCGCCTGTGCACTGCACGTCACCGAAACCTGCGGACCGTACCGTGAGTCGCTGCCGAAGCT
CGCCCGTTCCCTCGCCGACGCCCTCACGAGGGCGGGCTTGGACGTGCGGCTGGCGTCGGCGAGCGAACCG
TGCGATCCGGAGCGGTGCCATGCGCTCGTCCACCTGACTGCAGCCGATGAGGTGGGGCTGGCCGCGGCGG
AGCGGCTCGACCGACTGAGCGAGCGATGGGGGGTGCCGATCGCCCATGTCGTGGTGTGGGGCGGGGAGAT
ATGGCGGACCGAGGCGGGCACGGTGGGGGAGGACGGCCTGCCGCTCGCCGCGGGATGGCGCCGGCTGACG
GCCCTCCGTCCTGACACGGAGGAGCGCGTCCCGATCTCCCCTACCGCGGCGGTCGTGGTCGCCGGTCAGG
TGGCCGCTGATGTCCGCGACCGCCTCACGACCGCCACACGGGCCGGGCGCCGGCCCCGGTTGCACGTGGT
GGAGCCGGCGCGGCTCACGTGCCGCGCCCACCATTTCATCCCGCACTTTCACACCATGCCGCTCACCGGG
GACGCGCCGCTGGCCGAAGAGCTGACCGAGGAGGAGTTCTCCCGGCGGGCGGCCGCGCTGATGGACGACC
GCACCGGGGTGTTCACCGAGATCGCCGAAGGTGACTTCGGCCAGCTCCCGCTGCACGTCGCGGTGACCAC
CGTCGCCGATCCGGTGGGACTGCTCGGCCCGGCCGGGGATCGGCCGCGCGTGATCGGGGTGGGGCCGGAC
TTCGCCACCGCCCGGTATCGGACGGCGCGTGCCGCGATCGCCCTCTACGGTCTGCTCGCGGTGGATCCGC
GCCGCCTGGTCGATGCGGACGGTGAACCGCTGGCCGGGCCACGGACCTCCGCGGCGGAGCTGGAGGATCT
GCTGGGCAGGATCCGCGCGGGCGGGCTGCCGGCCTTCGTGCGCGCCGAGGACGTGCGCGGCGGCCCGCCT
CGGCTCCTCCCCGCGTCCTCGGTCTTCCCCTTTGCTACGGCGCGTGCCCTCCTCGCCGGAACCGTCCCCA
CGGGCACCGCCGTCGGCTACTCGGAGGAGGGCGCCCTCCGGGCCGCACTGCTCGATCACTGCCGCGAGCG
CACGCTCGCCGATCTTGCCAGCCGTCGGGTCGCCCGGCTCACTCCCGATACCGCTCCATCGGATCCGGTC
ACCGCCCGCTACCTGGCGTTCCTGCGCGCGATCGGCCTGCCGTTCGACGTGCTGGACGCGACGGGTCCGC
TGGGCGTCCCGGTGTACGTCGGGGTGCTCGACGGCCGGGTGGTGGCGGCCGAGGCCGGCGCCTCGCCCGG
GGAGGCGTTCCGTTCGGTGCTGGAAGGCATCCTCCGCGGTCTCCAGGGCATTCCAGCGGCCCGTTCGCTC
CCGGACACGCTCCCGCCGGTGCTCCCCGAGGCGATGGCCGTGCCCGACGGCTCCCCGTTGAGCGCGGAAG
CGCTCGCCGCCGCCTTGGCGCGGGCCGGGCTGTCGGTGTCGGTCGTCCGGCTCGACCACGATCGGCGGGT
GCACGCCCTGATCCCGCATTGTGTCCGCGTCATGGTGACCGGTGAGGAGAGCGCACATGTCTGA
 Primer design

Protein Sequence:627 a.a.
>Tbis_0554|ThioFinder438 Thermobispora bispora DSM 43833
MIPARPVLTPGVRYAPTSDGVAFLTRDGIVSITGVSIHRWIDRIAPHLTGERSVAELTDGLAPERRAFVL
RLLQALADRGLIIDAAGGREPRLERGTACALHVTETCGPYRESLPKLARSLADALTRAGLDVRLASASEP
CDPERCHALVHLTAADEVGLAAAERLDRLSERWGVPIAHVVVWGGEIWRTEAGTVGEDGLPLAAGWRRLT
ALRPDTEERVPISPTAAVVVAGQVAADVRDRLTTATRAGRRPRLHVVEPARLTCRAHHFIPHFHTMPLTG
DAPLAEELTEEEFSRRAAALMDDRTGVFTEIAEGDFGQLPLHVAVTTVADPVGLLGPAGDRPRVIGVGPD
FATARYRTARAAIALYGLLAVDPRRLVDADGEPLAGPRTSAAELEDLLGRIRAGGLPAFVRAEDVRGGPP
RLLPASSVFPFATARALLAGTVPTGTAVGYSEEGALRAALLDHCRERTLADLASRRVARLTPDTAPSDPV
TARYLAFLRAIGLPFDVLDATGPLGVPVYVGVLDGRVVAAEAGASPGEAFRSVLEGILRGLQGIPAARSL
PDTLPPVLPEAMAVPDGSPLSAEALAAALARAGLSVSVVRLDHDRRVHALIPHCVRVMVTGEESAHV