Home 

Gene Symbol:  
Tbis_0552
Organism:  
Thermobispora bispora DSM 43833
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
613557..614633 [1], 1077 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003651172.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1077 bp
>Tbis_0552|ThioFinder436 Thermobispora bispora DSM 43833
ATGGCCGCCGGCGAGCGGTGGTGGCGGTTCCGGGTGGACTACCACGCGGGCCCGATGGACGACCTGATCC
TCGACGGTGTGCGACCGGCGTTCGCCGCCTTCGCCGCGCAAGCACCCATGGCCTACTTTCTCCGCCACTG
GCGGCGAGGTCCGCACCTGCGGATCTATGTCAGCACCACGCGGGAGGCTCTGGAGGCCGTGGTACGCCCG
GCCATCGAGCACGTCGTGGGCGGTTACCTGCGGGCCCGGCCTTCCCCCGGGATGGCCGACCCGTCGGCCT
TTCTCCCGCTGCACGAGCGGCTTGCCGAGCTGGAGGGTGAGGACGGCCCGCTCATGCCGTGGTCTCCGGA
CAACACGATCCACGCAGAGGGGGAGAGACCGGAGCCCTTGACGGTGCGGGACGTGCTCCTAGCCGACTTC
TATGCGGACACCACCCCCTCCGTCTATCACGCGCTCGAACGGGTGAGATCCGGGGCCTCGCTGCCCACGA
TCGCCTTCGACCTGGTGGTCGCGACCGCCCACGCCCTTTCCACCGGGGGACTTCCGGTGGCACGGACCTC
ACTCCGCTCACATGCCGAGGCGTACCTGGCCCGGCGATCGGACGGCGTTCGGCTGCGCGAGCTGTGGCGC
GACCATTACGCGCGCAACCGTGAGGCCTTCACCGAACGGCTGATCGCGGTGGCGTCGTCAGCGGAGAGCG
CGGAGAACGGGGCGCACTTGCCGCATGTCCGGGAGTGGGTGCGGCGCTTGCGCCCGATCCGGGAGCGGGC
CCGGGCGCTCCTGGAGTCGGGTGAGCTGACGCTGGAGTACGCATCCCCGGCAGAGGGCGCACGGGACCTG
CCGTCGCTCGCCGAGGTGTCCGCGTTCCACCGGGAGCTCGAGTCGCGTCCCGAGTGGGCGAGACTGCGCG
ACTCCCCTGCCTTCGGCGCTTACCGATTGGTGATCAACTGTACGTACCTGCACCTCACCCGGCTGGGGCT
GACGCCGCATCAGCGGTTCCTGGTATGCCATCTCGCCGCCGATGCCGCCGCCGACGTCTATGGGATCGCC
GCGCACGAGGAGGTTGCCACCCGATGA
 Primer design

Protein Sequence:358 a.a.
>Tbis_0552|ThioFinder436 Thermobispora bispora DSM 43833
MAAGERWWRFRVDYHAGPMDDLILDGVRPAFAAFAAQAPMAYFLRHWRRGPHLRIYVSTTREALEAVVRP
AIEHVVGGYLRARPSPGMADPSAFLPLHERLAELEGEDGPLMPWSPDNTIHAEGERPEPLTVRDVLLADF
YADTTPSVYHALERVRSGASLPTIAFDLVVATAHALSTGGLPVARTSLRSHAEAYLARRSDGVRLRELWR
DHYARNREAFTERLIAVASSAESAENGAHLPHVREWVRRLRPIRERARALLESGELTLEYASPAEGARDL
PSLAEVSAFHRELESRPEWARLRDSPAFGAYRLVINCTYLHLTRLGLTPHQRFLVCHLAADAAADVYGIA
AHEEVATR