Home 

Gene Symbol:  
sce9071
Organism:  
Sorangium cellulosum 'So ce 56'
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
12631458..12634073 [1], 2616 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001619723.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2616 bp
>sce9071|ThioFinder463 Sorangium cellulosum 'So ce 56'
ATGAGCTGGATCTACCGGAAGCTGTTCCACGATCGGGGCCTCGAGGGGGAGGGGACCGACGCGCTCCTCC
TCGGGCTCGTCGATCCGCTCGTGTCCGAGCTCGAGCAGCGCGGCGCGATCGATCGCTTCTTCTTCCTCCG
GTACGCCGAGGGAGGCGACCACCTGCGGCTGCGCGTGCGCGTGGCGCCCGGGCGCGACCCCGTCGACGTG
GCGGCGCGCGTGGACGCGGCGGCGGCGTGCTGCGCCGCCGTGTCGCGCGCGGAGGCCGCCGTTTACGAGC
CGGAGCTCGAGAAACACGGAGGGCCCGCGGGGATGGAGATCGCGGAGCGGCAGTTCTTCGCGTCGAGCAG
GTTCGCGCTCGGCTGCATCCGGAAGACGGCGGGGCGACCGCGGGCGCGCGCCCTCGTCGCGGCGTGCGCG
CTCGACGCGCTGCTCGCGCGCGCGGGCGTCACGGGCGACGCGCGGCGGTCGTTCCTCGCGGGGTACGCGC
GGCACTGGCGCGCGTTCGCCCGCGCGATCTCGGGCGTGGAGCTCGTCTATGAAGCGCCGGACGCCGAGTC
GGTCGCGCTGGTGCGCGCGCTCGTGCGGGGAGAGGGGCTCGCCGCGCTCGGCGAGCTCGTCGCCGGCGAG
CGCGCGCTCCTCACCGCGTTCGACGCGGATCTGCCCGAGCTCGCCGAGGCGTCGCGGCGCGGAGCGCTCG
GCGTGCCGCTGGCGACGGTCCTGACCAACCTCGCCCACACGTTCCATAACCGCCTCGGGCTCACGCTCGC
CTTCGAGGTGTGGGTGGCCGACGCGCTCGCCGAGGCAGGCGCCCCGCACGAGCCGCCGCGGGCTCGCCCG
CCGGGCGTCTCGCCGGGCGAGGCGTGGCAGCGCCTCGCCCGCGCGGCCGAGCAGCGCCGGCCCGTCACCG
CGCTCCTCGACCCCTGCGATGGCGCCGCGCTCGACGCGCTCCGCGACGCAGCCCGCCGCGACGGCCTCCG
GTTCATCGCGCCCGCCGCGCCCGCCGGCGGGATGTCCGCGCCCTTCGCGCTGCTGCGCGCCCTCGCGGAC
GCCCACCCGGCGGGCGGCGCGCTCCTCGCTGCCCTCGGCCGCATCGAGGCCGCGCACGACGCGCCGGAGT
GCCCGCTGCCGCCCGACCCGGCTTCCGTGGCCGAGGCGCTCCGCGCCTTCCTCGCGGAGCACACGCTCGA
GCCCACGGTGCTCGTCCTCCGCGACGTCGACGGCGCCGACGCCGACACGCAGCACGCCGTCGCGTTCCTC
GCGCGCGCCCTGGAGACGGAGCCGCTCGCCCTCGTCGTCACCGCGAGCGGGCGCCCGAGCCCCGGGTGGG
CCGCGATCGTGGCCGAGATCGAGGAGGGGCCGGGGCTCCTCCGCGTCGCGACCGCGCCCGCGCCCGCGCT
CGAAAGCGAAGCGGCCGCCCCCGCCGTGACGCCGGGGCCCGCGACGGTCGCGCGGGGCGAAGCGTTCTGC
CGCGCCGGCGCGCTGCACGAGGCCGCCGCGATCCTCGGCGACGCCCTGGCGTCGCCCGGCCTCTCTCCCG
AGGCGCGGGCCGACGCGCTCGTGGCGCTCGCGAGGACGATGCTCCGCATGTCGCGCCCCGCCCTCGCGCG
GCAGGCGGCGGAGGCGGCGCTCCGCCTCGGCCTCCCGGAGCGCCGCCGCGCGCTCGCGCGGCGCGTCCTG
CTCGCCGCGCTCCACAACCTGGGCGAGACCGCCGCGCTCGACGCGCTCCGGGACGACGTCGCTCAGCAGC
GCTCTGCGCCCGGCGCGTCCGCCGCGGAGCGCTGCTGGGCGGAGCTCGACGCCGCGCTCGTGTGCGCGAC
CGGCGAGCGCCGCGCCGAGCACGAGGCGCGGCTCGACGCGCTGCTCGCCGCGCCGCGCGGCGACGTGCCG
CCGCAGTGCCTCGCCGCCGCGCACGCGTGGCGCGGCGCCGCGCATGCGGCCAGCGGCGAGCACGAGCGCG
GCCTCGCGCACCAGCGCCGGGCGCTCGCCTTCGCCGAGGAGCTCGCCGATTTCCGCCGCGCCCTCATGGT
GCGCGTGCGCCTCGCGAGCAGCGTCGCGGCCGCGGGCGAGCTCGCCGAGGCGGCGGCGCTCTTCGAGGTC
GCGGCCTGTCACGCCGCGTGGATCGGCCTCTTCGACCTCGCGTCGCTCGCCGCGCAGAACGCGATCTCGC
TCGGCCTCGCGCGCCGCGACGCGGCCCCGGTCCGCGCGTGGCTCGACGGCGCCCGGCCCGCGCGCGCCCG
CGTGTGGCGCTCGCCCTACGGCGAGCTCGCCGTGCTCTACGCGCGCGCCGAGTCGGCCCTCGCGCGGGGG
GAGGCCGAGGCGGCGGGGGCGCACCTCGATCGGCTGCGCGCGCGCCTCGCCGCGCTCGGGGGGGCCGCCC
CGCGGAGCGCGCCCCTGCTCGCGCTCGCCGCGGCGCACCTCGAGGCCGACGTCGCTGCCGCCGCGGGGGA
CGACGCCGGCAGGGCGGCCGCGCTCGCGCGCGCCGCGGAGCTCACCCCGGGCGTGCCGCCGGAGGAGCGG
CGGCTCGTCGCGGCCATTGCCCGCGCGCGGCGCGACGCCTGCCGCGGCGACGGCCGCCGCGACAGGCCGG
TGGTCCTCGGTTTGCAGAGCACTTGA
 Primer design

Protein Sequence:871 a.a.
>Sce9071|ThioFinder463 Sorangium cellulosum 'So ce 56'
MSWIYRKLFHDRGLEGEGTDALLLGLVDPLVSELEQRGAIDRFFFLRYAEGGDHLRLRVRVAPGRDPVDV
AARVDAAAACCAAVSRAEAAVYEPELEKHGGPAGMEIAERQFFASSRFALGCIRKTAGRPRARALVAACA
LDALLARAGVTGDARRSFLAGYARHWRAFARAISGVELVYEAPDAESVALVRALVRGEGLAALGELVAGE
RALLTAFDADLPELAEASRRGALGVPLATVLTNLAHTFHNRLGLTLAFEVWVADALAEAGAPHEPPRARP
PGVSPGEAWQRLARAAEQRRPVTALLDPCDGAALDALRDAARRDGLRFIAPAAPAGGMSAPFALLRALAD
AHPAGGALLAALGRIEAAHDAPECPLPPDPASVAEALRAFLAEHTLEPTVLVLRDVDGADADTQHAVAFL
ARALETEPLALVVTASGRPSPGWAAIVAEIEEGPGLLRVATAPAPALESEAAAPAVTPGPATVARGEAFC
RAGALHEAAAILGDALASPGLSPEARADALVALARTMLRMSRPALARQAAEAALRLGLPERRRALARRVL
LAALHNLGETAALDALRDDVAQQRSAPGASAAERCWAELDAALVCATGERRAEHEARLDALLAAPRGDVP
PQCLAAAHAWRGAAHAASGEHERGLAHQRRALAFAEELADFRRALMVRVRLASSVAAAGELAEAAALFEV
AACHAAWIGLFDLASLAAQNAISLGLARRDAAPVRAWLDGARPARARVWRSPYGELAVLYARAESALARG
EAEAAGAHLDRLRARLAALGGAAPRSAPLLALAAAHLEADVAAAAGDDAGRAAALARAAELTPGVPPEER
RLVAAIARARRDACRGDGRRDRPVVLGLQST