Home 

Gene Symbol:  
sce9070
Organism:  
Sorangium cellulosum 'So ce 56'
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
12628903..12631461 [1], 2559 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001619722.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2559 bp
>sce9070|ThioFinder462 Sorangium cellulosum 'So ce 56'
ATGAGCCGCGGGCTCCAGATCGCGCCGTGGGGCGCGCTGCGCATCGCGGGGATGCCGGCCGACGCGCTCG
CCGGGCTCCGCCTCCGCGAGAGCCCCGCGGTCGAGCGCGAGCTCGCCGTGGCCGAGCTCGAGCTCGCGGC
CGCGCGGGAGGACGCGGCGGCGCGCATGTTCGACGTCGTGCGCGGGTGCGAGGACGAGGCGCTGCGCCGC
GCGGCGCTCGAGGTGAAGCGGCGGCTGTTCAACGGAAAGGCCGTGGCGGCCGGCGCGCTCGAGGGCGCGA
GGACCGCGCCGCCGGAGGGGGCGCGCGCCGCGCTCGCGCTCGTCGACGCGCGCGCGGCCCGGTGCGCCGC
GCTGGAGGAGCGCTACGAGGCGACGTTCGCCGCGGAGTGGATCGCCGCGTCGGAGCGCTTCCGGCAGACG
CTCGGGAGCTCGCGCCTGCTCGGGGGGATCCTGCTCTCGAGCGCCGACCATTATACCACGGCGCAGAAGC
TCGCGGAGATCCCGAGCGGCGCGCCGCTCACCTCGGCGCAGCAGATCCGCGAGGCCACGATCGCGCGTTA
CGTCTTCCGCGCGACGGCGCGGACGACGCCGTTCGCGGGGTTCGCGGGCGTCGCGCTGCTCGACCTCTCC
GCGTCGCCCCCGGACGTCGGTGACGCGCCGCGCGCGCCGCGCACGCCGCGCACGTCCGACGAGGCGCGGT
GGCGCAGCCTCCCGCAGCTCGCGCTCGCGCACGCCGGGGAGCTCGTCGCGCGCGCGATCTCTTCTCAGCC
GGCGGCTCACGCCCACGCACGCGCGCGCCTGCCGCTCCGGATGAACCCGCTCCGGCGCTTCGCGGCGGGC
GCCGCGCCGTCGGTCGTGTTCTCGCGCGCCCGGTCGGGCGAGGTGATGTCGCTCGGGTGGACCCCCGCCG
TCGCCCGCCTCGTCGAGGGCGCCGAGGGGCGCACGCTCGAGGACGCCGCCCGGGCGCTCGCGTCGGACGA
CGCCGACGAGCGAGCGTGCCGCGACGTGCTCGAGCAGCTCGTCGAGGCGGGCATGCTCGAGCCGGCGAGC
GTCCCAGTGGGGCCGACCCCTGCGGCGCTGCGCGCCGCGGCGGACGCCCTGGGCGAGATCGGGTGCGCGG
GCGCGCCGGACGAGCTCCGCTCGGTCGCGCGGCGCCTCGAGGACTACGCGACCGCCGGCGTCGAGACCCG
CGCGCGCCTCGCCGCCGAGCTCGGCCGCGGCCCTGGGCGCTCGTCCTTGCTCGAGGACGTCATGGTGGAC
GGCGCCTTCGGCGCGGAGCTCCCTGTCCCACGCGGGGCGCTCGCCGAGGCGCTCGAGCCGGTCGTGCGCT
TCGTGCGCGCGAGCGCCTGCGGGGCCGCGCACCGCCGGCTCTGCGCGGCGTTCATCGAGCGGTTCGGCCG
TGACGGCGTGTGCGACGACGTCGGCGGGTTCGTGACCGAGATCCTCGAGGACCCGCGGCGCGTCGCGCTC
ATCCGCGGCGCGTCCGAGCCGATCCGCTGGATCGACGCGGAGCTCGGCCGCGTCGCCGCCGCGGCGACGG
GCGACGCCGTGCGCCTCGATCCAGGCCTCTTCGAGGGGCTCGCCGCCCCGGACGCGCCGTCGTCGATGGC
GCTCTTCCTCCAGATCGCGCCTCCCTGCCCGCGCGACGGCGGAGCGCCGCGCGTCGTGCTCAACGGCGCG
CAGGCCGGGCGCGCGAAGTACCTGTCGCGCTACCTCGCGGACGTCGAGGGGCGCGCCCCTGAGGCCCTCG
AGGCGATCCGCCGCCGCCTGGCGCGGGAGGACGGTCCGCTGCCCGTCGAGCTTTCGCCCACGCTCGGCCT
CAACTTCCAGGTGCACCCGCGCCTCACGGCGTGGGCGCTCGAGGTCCCGTGGGAGCCGAGCGCGCCGGGC
GACAAGGTCCTGCCGCTCCGCGATCTCTCCCTCCGCTTCGACGCGGCGGCGATCGAGCTCCGGCTGCGAT
CGCGGCGCCTCGGCCGAGAGATCGAGCCGATCCACCTCGGCTTCCTGCGGGACGCCGCGCTCCCCGATCC
GCACTTCCTGCTCCGCGCGCTCTCGCCGCGGCTCCGCGACGACACGGTCGCGGAGCGGGCGGACCTCTAC
AACGTGCTCGATCGCCTCGACCTGGCCCGGGGCGCCGCGCTGGCCCCGCGGCGCCCGCGCCTCACGGTCG
GTCGCGTCGTGGTGGAGCGCGCGCGGTGGGCGATCCCGGTGAGCGCGATCCCGCGCAAGGAGCCGAAGCA
GCCGTACGCGTCGTACTTCCGCGCGATCGCGCGCCTGCGGCGCGAGCTCGATCTCCCGAGCCGGGGGTTC
GCCCGGTACGTCGGGCGGGAGGTGGCCGGCTTCGGCTTCACCGAGACGAACATGTACGTCGACTGGGAGA
GCCCGTTCACGCTGATCGGGCTGGCTCGCCTGCTCGGCGGTCCCGGCGGCGGGACGAGCGGGTACCTCGT
CTTCACCGAGCTCCTGCCGGAGCCCGAGGCGTCGTGGCTGCGCCTCGACGGGAGGCCGCACGCGGCGGAG
CTGCTCGTCGAGATCGACGGCGAGAGGAGCGCGCGATGA
 Primer design

Protein Sequence:852 a.a.
>Sce9070|ThioFinder462 Sorangium cellulosum 'So ce 56'
MSRGLQIAPWGALRIAGMPADALAGLRLRESPAVERELAVAELELAAAREDAAARMFDVVRGCEDEALRR
AALEVKRRLFNGKAVAAGALEGARTAPPEGARAALALVDARAARCAALEERYEATFAAEWIAASERFRQT
LGSSRLLGGILLSSADHYTTAQKLAEIPSGAPLTSAQQIREATIARYVFRATARTTPFAGFAGVALLDLS
ASPPDVGDAPRAPRTPRTSDEARWRSLPQLALAHAGELVARAISSQPAAHAHARARLPLRMNPLRRFAAG
AAPSVVFSRARSGEVMSLGWTPAVARLVEGAEGRTLEDAARALASDDADERACRDVLEQLVEAGMLEPAS
VPVGPTPAALRAAADALGEIGCAGAPDELRSVARRLEDYATAGVETRARLAAELGRGPGRSSLLEDVMVD
GAFGAELPVPRGALAEALEPVVRFVRASACGAAHRRLCAAFIERFGRDGVCDDVGGFVTEILEDPRRVAL
IRGASEPIRWIDAELGRVAAAATGDAVRLDPGLFEGLAAPDAPSSMALFLQIAPPCPRDGGAPRVVLNGA
QAGRAKYLSRYLADVEGRAPEALEAIRRRLAREDGPLPVELSPTLGLNFQVHPRLTAWALEVPWEPSAPG
DKVLPLRDLSLRFDAAAIELRLRSRRLGREIEPIHLGFLRDAALPDPHFLLRALSPRLRDDTVAERADLY
NVLDRLDLARGAALAPRRPRLTVGRVVVERARWAIPVSAIPRKEPKQPYASYFRAIARLRRELDLPSRGF
ARYVGREVAGFGFTETNMYVDWESPFTLIGLARLLGGPGGGTSGYLVFTELLPEPEASWLRLDGRPHAAE
LLVEIDGERSAR