Home 

Gene Symbol:  
sce9069
Organism:  
Sorangium cellulosum 'So ce 56'
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
12628298..12628906 [1], 609 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001619721.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:609 bp
>sce9069|ThioFinder461 Sorangium cellulosum 'So ce 56'
CTGCCCGCGCCGCGCGCGCTCGAGCCGGTCCAGCGCTCGCTCGCGTCGGTCATCGCCGCGCGGCGGAGCG
GAAGGCTTGCGGCGGGCGCCCTCGACGCGGCGACGCTCGGGACGCTGCTCGCGGCCGCCGCGGCGCGGCC
GGCAGGGCTCGCGGACGCGACGCTCGATCCGCTGCTGTTTCCGGTCGTCTTCGACGTCGACGGTGTCCCG
CCCGGCGCGCACCGGTACGACCGCGGCGAGCACCGCCTCGCGCCGATCGGCCCGGCGTCGCGCGCGCGGA
TGGCCGAGACCGCGATCCTTCAGCGCGAGCACGCCATGGGCGCGGCGGTGCTCTTCCTGGTGGTCCCGAT
CGGGCGGTGGCTCGTGGCGTTCGGCGATCGCGGCTACCGGGGCGCGGCGTTCGCGGCGGGGTGGCTCACC
GACCGCCTTTACCTCGTCGCGGAGACGCTCGGGCTCACCTACACGGCGACCGGCGGCTTCGCCCCCGCGG
TCGTCGACGAGGTCCTCGGGCTCGACGGCCGCGATCATACCGCGTTCTTCGCGTTCGCCGTCGGAGGGCA
CCGCCAGCCGACGCCCCGAGAGGCGCCTCGCGGAGGGCAGCCGCGATGA
 Primer design

Protein Sequence:202 a.a.
>Sce9069|ThioFinder461 Sorangium cellulosum 'So ce 56'
MPAPRALEPVQRSLASVIAARRSGRLAAGALDAATLGTLLAAAAARPAGLADATLDPLLFPVVFDVDGVP
PGAHRYDRGEHRLAPIGPASRARMAETAILQREHAMGAAVLFLVVPIGRWLVAFGDRGYRGAAFAAGWLT
DRLYLVAETLGLTYTATGGFAPAVVDEVLGLDGRDHTAFFAFAVGGHRQPTPREAPRGGQPR