Home 

Gene Symbol:  
sce9072
Organism:  
Sorangium cellulosum 'So ce 56'
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
12634130..12635413 [1], 1284 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001619724.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1284 bp
>sce9072|ThioFinder464 Sorangium cellulosum 'So ce 56'
GTGGAGACTCAGACCAAGCTTCCGCCCATGCCGGGGCTCTCGGGCCCCGAGAAGAAGCGCTTCATGAACG
GCACCCACCGCACGGCCTCGCCCGAGGAGACCTTGGATCGCATCAAGGGCTTCATGCCGGCGATGGGGAT
CACGCGGATCGCCAACGTCACGGGGCTCGACGCGATCGGGATACCGGTCGTCGTCGTCTGCCGCCCCAAC
TCGCGCTCTCTCTCGGTCAGCCAGGGAAAGGGGCTGACGCTCGCGGCGGCGAAGGTCTCGGGGCTGATGG
AGTCGATCGAGGCCTATCACGGCGAGAACATCGTCCGGCCGCTGCTCCTCGGCTCCTCTCGCGAGCTCCG
GCGCTCCCACGCGATAGCCGACGTCTCCGCGCTGCCGCGGACCTCGAGCGTGCCGTTCGACGAGGACACC
CCGCTCCTGTGGGCCGAGGGCTACGACCTCATGCGCGGCGCCCCCGTGTGGGTCCCCTACGAGCTCGTGC
ACGTCAACGCCACCGCGACGGGCCGCGTCAACCCGGGTATCTTCTGCTGCTCGACCAACGGGCTCTCGTC
GGGGAACGGGCTCCTCGAGGCGGTGAGCTACGGTATCTGCGAGGTGGTCGAGCGCGACGCCACGGCCGTG
TGGGGCGCCCTCACCGACGAGGAGCGGGACGCGAGGCGGCTCGATCTCGACAGCATCGACGATCCCGGCT
GCCGCGAGGTGCTCGCGAAATTCGCGGCCGCCGGGGTCGCCGTCGGCGCGTGGGAGACCACCTCCGACGT
CGGTATCCCCTCGTACGAGTGCCTGATCGCCGAGCGGACGGAGGACGCCGTCCGGGCGCTCCACGGCTCC
GGCGGGCAAGGCTGCCATCCGTCGCGCGCCGTCGCGCTGCTGCGCGCCCTCACCGAGGCCGCGCAGACCC
GGCTCACGGTCATCTCGGGCGCGCGCGACGACCTCCTCCGGGCCGAGTACGACCGCCACCGGAGCCCCGA
TCAGGTCCGGCACGTCCGCCGGCTGCTGACGGCGCGCGGAGAGCGCCCGTTCTCCGCGGGCCCGACGTTC
GCGGGCGACACGTTCGAGGACGACGTCGCCTGGCAGCTCGAGCGGCTGCGCGCGGTCGGGATCGACAGCG
TCGTCGCCTTCGATCTCACGAAGCCGGAGTTCGGCATCCCCGTCGTCAAGATAGTTATCCCCGGGCTCGA
AGGGATCCACTCGTTCCCCAACTACATCCCTGGCCGCCGGTTCCGCCGCGCGCTCGAGCGCCGGAGCGCG
GTGAGCGTGAAGGAGATCGCATGA
 Primer design

Protein Sequence:427 a.a.
>Sce9072|ThioFinder464 Sorangium cellulosum 'So ce 56'
METQTKLPPMPGLSGPEKKRFMNGTHRTASPEETLDRIKGFMPAMGITRIANVTGLDAIGIPVVVVCRPN
SRSLSVSQGKGLTLAAAKVSGLMESIEAYHGENIVRPLLLGSSRELRRSHAIADVSALPRTSSVPFDEDT
PLLWAEGYDLMRGAPVWVPYELVHVNATATGRVNPGIFCCSTNGLSSGNGLLEAVSYGICEVVERDATAV
WGALTDEERDARRLDLDSIDDPGCREVLAKFAAAGVAVGAWETTSDVGIPSYECLIAERTEDAVRALHGS
GGQGCHPSRAVALLRALTEAAQTRLTVISGARDDLLRAEYDRHRSPDQVRHVRRLLTARGERPFSAGPTF
AGDTFEDDVAWQLERLRAVGIDSVVAFDLTKPEFGIPVVKIVIPGLEGIHSFPNYIPGRRFRRALERRSA
VSVKEIA