Home 

Gene Symbol:  
Amir_3866
Organism:  
Actinosynnema mirum DSM 43827
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4531948..4533504 [1], 1557 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003101591.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1557 bp
>Amir_3866|ThioFinder486 Actinosynnema mirum DSM 43827
ATGACGTGGACCGGTGCGCACGTGCGGTTGTCGTGGGCGGTGGAGCACGTGGACGCGTTCATCGTGGACG
TGCTCGCCCCGGCGATGGGCGGGGAGTGGTTCTACGTGCGGTACGGGGAAGGCGGGGCGCACTTGCGGGT
GCGGGCTCGGGACGTTGGCCTGCCGGGGAAGTTGCGCGCGCTGGTGGCCGGGGTGGAGCACCCGGTGGTG
GCGGACGGGACGGTGGCGGACGGGACGGCGGCGGACGGGGCGGCGGCGGACGGGACGGTGGCGGACGGGA
CGGCGTGGCCGCACGGGGAGGTGCGGGAGGTGCGGTACGAGGCGGAGGTCGCGCGGTACGGCGGGGTGGA
GCTGATGCCGGTGGCGGAGGGGGTGTTCTGCCGCAGCACCGAGGTCGCGGTGGCGGTGCTGCGGTCGGCG
CGCACGGCAGGCGCGCGCTTCACGGCCGCCGTGGAGCTGGTGATGGCGACGGCCAGCGCGGTGGGGTTGG
ACCGGGCGGGGGCGGCGGCGTGGTTGCGGTCGTTGGCGTCCGGGTGGCGGCGGACCGAGGAGGCGGTCGC
GCCTCCGGGGGTGGCCTCGCACGCGGTGGCCCGGTCGTTGCACGCGGCGCGCGGGGCGCAGTTGGCCGAC
CGGTGGGAGCGGTTGGAGGGCGGGGCCACGGGGGCGGTCGCGTACTGGGTGGAGTGCGTGCGGGGGGCCG
GGTTGCCGGTGCACGTGTGGGGCTCGCAGTTGCACATGCTGCTGAACCGGCTGGGGATCACGCCCGAGGA
GGAGCGGGTGGTGTGCAGGCTGGTGGCGATGACGGCTGAGGCTCCAGGGGTGGTGGAGGGCGTGCACGGG
GGTGAGGCGGACCGGCGGTACCTGGTGGCGAGCAAGTACCACGTGGGTGAGCCGGATCAGGGGCCTCGGG
CGGAGCCGGTGGTGGCGTTCGGGGCGTTGCCGTGGCAGCGGGTGGTGGAGCTGCCGGACGCGGTGGCGCC
GTCGGTCTCGCTGGTGGAGGCGTTGGCCGCGCGGCGGACGGTGCGTGGGGAGGCGTTGGCGGGTGGGCTG
GACGCGGTGAGGCTGGCGACGTTGTTGTGGACGGCGCACGGGGCTCTGCCGGACGGGCGCAGGCCGCACC
CGAGCGCGGGCGGGCGGTACAGCGCTCGGGTGCGGGTGCTGGTGTGGCGGGTGGCGGGGGTGGAGCCCGG
TGTGTACGACGTGGACGAGGTGCGGCGGGTGCTGGTGCGGGTGGCCGAGGCGCCGCCGGAGCGGGATGTG
GTGGTGAGTTCGATGTGGTTCGGGCGGGGGGAGGATCGGGTCGACCCGGTTGGGGTTCCGGCGGTGTTGG
CGGTGTACGCGCGGGTGGGGGTGCTGCGGCGGTCTTACGGGACTCGGGCGTTGCGGTTGGCGCTGGTGGA
GGGTGGGCACCTGGCGCAGAACCTGGCGTTGGTGGCGGCGGCTTGTGGGGTGCGGTTGGGGTTGTTCGGC
GGGTTCCACGATGACGTGGCGCATGACGTGCTGTGCCTGGACGGGGTGGACGACGTGCTGGTCTACCTGG
CGCCGGTGGCCGGGTGA
 Primer design

Protein Sequence:518 a.a.
>Amir_3866|ThioFinder486 Actinosynnema mirum DSM 43827
MTWTGAHVRLSWAVEHVDAFIVDVLAPAMGGEWFYVRYGEGGAHLRVRARDVGLPGKLRALVAGVEHPVV
ADGTVADGTAADGAAADGTVADGTAWPHGEVREVRYEAEVARYGGVELMPVAEGVFCRSTEVAVAVLRSA
RTAGARFTAAVELVMATASAVGLDRAGAAAWLRSLASGWRRTEEAVAPPGVASHAVARSLHAARGAQLAD
RWERLEGGATGAVAYWVECVRGAGLPVHVWGSQLHMLLNRLGITPEEERVVCRLVAMTAEAPGVVEGVHG
GEADRRYLVASKYHVGEPDQGPRAEPVVAFGALPWQRVVELPDAVAPSVSLVEALAARRTVRGEALAGGL
DAVRLATLLWTAHGALPDGRRPHPSAGGRYSARVRVLVWRVAGVEPGVYDVDEVRRVLVRVAEAPPERDV
VVSSMWFGRGEDRVDPVGVPAVLAVYARVGVLRRSYGTRALRLALVEGGHLAQNLALVAAACGVRLGLFG
GFHDDVAHDVLCLDGVDDVLVYLAPVAG