Home 

Gene Symbol:  
Amir_3861
Organism:  
Actinosynnema mirum DSM 43827
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4524018..4526471 [1], 2454 bp
Product Function:  
Lantibiotic dehydratase domain protein
Product Locus:  
 YP_003101586.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2454 bp
>Amir_3861|ThioFinder481 Actinosynnema mirum DSM 43827
ATGACAGGCCACGGCACCAGCACCGAACTCGCGCCGTACGCGCTCGTCCGGGTGGCCGCGCTCGCCCACC
CCGGTCCGGCGGGCTCGGACTTCCGCGCCGCGCTCGCCGCGCTGGCCGCGGTGGAGGCCGACCTCGCCGC
GCTGGCCGGGGACCTGGCGGAGGCGCTGCACGACAGCGCCGCGCACCACGGCGCCGACTTCCACCGCGCG
GTCGTGCTCCCGCTGCGCCGCGACGTGCACAACCACCGCCCGCCGCACCACGGGCGCGACCTGGGCGACC
TGCCGGAGCGCGTCCCGCTGCTGGCGAGGTGGCTGGCGGCGCACGGGGCGCGGGCCGAGGCGGAGGCTGC
GGCGCTGGCCGCGTGGCCGGACGCGCTGGCGAGGTCCAGGGCGTGGCTGGCTCGGGTGTGCGCGGCCGAC
GCGCCCCGGCTGGCGAGCGCGCTGACCGGCGCGGACCTGCTGCAGGGCATGGACCGCACGGCGCGCCTGC
GCGGCGTCCCGGACCGCAGGGCGCGCAAGGCCGAGCCGACGCTGCTGCGCTACGCCCTGCGCGCCACCGC
GAAGACCAGCCCGCTGTCCTGGCACACCCACGTCGGCTGGTCGACCTGGGACGACCGGGCGGTGGCTCCC
CCGCTGCCGGGACCCGCGGTGTCGCACCCGGCGGCGCACCGGTTGCTGGTGACCAGGTTCGCGACCGCGC
TGGGCCCGCTGCTGCCGCACCGCGTGGCGGCGGGGCTGCGGGTGCGCGACGGCCGGGTGCTGTTCCGCCG
CGACACCCCGGTGGCGGGCGTGGGGCGCGCGGACGTGGTGCGCGAGGAGGAGGTGGACGTCGCCGCCACC
GGCCCGCTGCGGTTCGTGATCGCGCTGGTGCGCGACGCGGGTCCGCCGGGACTGCGGCCGGCGGAGGTGG
AGGCGGCGCTGGCGGCCCGGCTCCCGGAGGGGTCGGCGGACGCGGCGCGCGGGTTCGTCGCGCGGGCGCG
GGAGCTGGGGCTGCTCGTCCCGGTCCCGCCGGTGCACCCGCAGGAGCGGGACCCGCTGACCGCGCTCGCG
ACCTGGCTGGCCGACCAGCCCGCCGGGCAGGCGAACCCCGACCCCGCCGCCTTGGCCACCAGGCTGACCG
CGCTCGCCAGGACCACCGCGGAGTTCGGCGTCACCCCCGCCCCCGCCAGGGCCGCCGTGCTCGCCGAGCT
GTCCGGGGGCTGGCGGGAGCTGGGCGAGCGGGTGGGCGCGGACCTGACCGGGGTCGCGCCGGTGGTGGAG
GACGTCGTGCTGCCCGAGGCGACGACCACCCCGCTGGGCGCGTTCCCGGAGCTGGCCCTGCTCACCCCGC
TGCTGATCGCGTTCGACCAGCACGTCCTGCTGCGCCGCCTGATCACGGCCAGGTTCACCGAGCGGTTCGG
GGTCGGCGGCGTCGCCTCGCCGGCCGACAGCTCGGGCCCGATCACGGCGGCCTGGCAGGACAGCACGTCC
CCGGTCGTCCCGACCGATCCCGCCGCGCGCGAGCTGCTGGCGGTGCGGGAGGAGCTGGCCGGGGCGGTGC
GCGGCGGCGTGATCACCGACGCGCTGCTCGACCGGGCGGCCGGGCTGCTGCCCGCGTGGACCACCCGGCG
TCCCGGCTCGTACGGCTTCTTCGCCCAGCCCACCGGCGACGGCCGCCTGGTGGTCAACCGGGTGTACTCG
GGGTTCGGCAAGTTCACCAGCCGCTTCCTGGACCTGCTGCCGGGCGCGCGCGAGGCCGTGACCGCGCAGG
TGCTGCGGCACACCGACGACCCGGTGCAGTTCCGCCCGGTGCGCGGGTTCAACCCGAACCTGCACCCGCT
GGTGGGGGCGCGCGAGGTCGGCGAGGACGCCCGGTGGGCCGACCTGCTCGCGGACGACCTGGACGTGCGG
CACGACCCGGACGCCGACGAGGTGCGGGTGACCCTCCAAGGCCGCCCGCTGGACGTGCTGTACCTGGGGT
TCATGGTGCCGATCTCGCTCCCGGACCGGCAGGCGGCGCTGTACTCGGACCTGTCCTGCGGGTGGATCGA
CCTGGACGCCCTGCGGGAGCGGGAGGTCGACGGCGGGGTGACCCGGCTGGGGCCGCTGGCGCACCGGAAC
GTGGTGCTGGCGCGCCGGTCCTGGGGGTTCCCGGTCCCCCCGGTGGTCGGCGCGGAGGAGCGGGCGGCGC
TGGACGTGGCGCTGCTGCGCGCCCGGCACGGGCTGCCCGAGCACGTGTTCGTCGGACCGGACGGCGCGCC
CGACTCGGCCGAGGCGTACCGGCACGCGCTGACGGCGCGCAAGCCGCAGTACGCCGACCTCGGCGACCCG
CTGCACCTGCGCTGCCTGCCGCGCCTGCTGGCCGGTTTCCCGGACGGGGTGCGGTTGACCGAGGCGCTGC
CCGTGCCGGGGACCGCCGCGCCGGACGGCCGGGTGGTCGAGCTGGTCGCGGAAACCTACTGGAGGAACTC
GTGA
 Primer design

Protein Sequence:817 a.a.
>Amir_3861|ThioFinder481 Actinosynnema mirum DSM 43827
MTGHGTSTELAPYALVRVAALAHPGPAGSDFRAALAALAAVEADLAALAGDLAEALHDSAAHHGADFHRA
VVLPLRRDVHNHRPPHHGRDLGDLPERVPLLARWLAAHGARAEAEAAALAAWPDALARSRAWLARVCAAD
APRLASALTGADLLQGMDRTARLRGVPDRRARKAEPTLLRYALRATAKTSPLSWHTHVGWSTWDDRAVAP
PLPGPAVSHPAAHRLLVTRFATALGPLLPHRVAAGLRVRDGRVLFRRDTPVAGVGRADVVREEEVDVAAT
GPLRFVIALVRDAGPPGLRPAEVEAALAARLPEGSADAARGFVARARELGLLVPVPPVHPQERDPLTALA
TWLADQPAGQANPDPAALATRLTALARTTAEFGVTPAPARAAVLAELSGGWRELGERVGADLTGVAPVVE
DVVLPEATTTPLGAFPELALLTPLLIAFDQHVLLRRLITARFTERFGVGGVASPADSSGPITAAWQDSTS
PVVPTDPAARELLAVREELAGAVRGGVITDALLDRAAGLLPAWTTRRPGSYGFFAQPTGDGRLVVNRVYS
GFGKFTSRFLDLLPGAREAVTAQVLRHTDDPVQFRPVRGFNPNLHPLVGAREVGEDARWADLLADDLDVR
HDPDADEVRVTLQGRPLDVLYLGFMVPISLPDRQAALYSDLSCGWIDLDALREREVDGGVTRLGPLAHRN
VVLARRSWGFPVPPVVGAEERAALDVALLRARHGLPEHVFVGPDGAPDSAEAYRHALTARKPQYADLGDP
LHLRCLPRLLAGFPDGVRLTEALPVPGTAAPDGRVVELVAETYWRNS