Home 

Gene Symbol:  
Amir_3865
Organism:  
Actinosynnema mirum DSM 43827
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4530818..4531948 [1], 1131 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003101590.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1131 bp
>Amir_3865|ThioFinder485 Actinosynnema mirum DSM 43827
GTGGGCGTGGGCGGGGCTCGGGGTGGCAGCGGGGTCGGGGACGAGCGGGCGGCGCTGGCGGAGGCGTACG
CGCACGGGCCGGGGCGGGTGGTGGAGCCGGGGGTGTCGCCGGCGGTCGCGGCGGCTGCGGGTGCGCGGAT
CCCGTTGCGCGCGCTGGCCGGGTGCGGGCGGTTCGGGGCGGCGGTGGCGCACCTGGTGACGGCGGTGGCG
ACGCCGCTGCGGTGGGAGCCGTGGAACCAGTACAACGACCACCGCGCGTACCCCTCGGCCCGTGCGGCGC
ACACCGTGGACCTGGTGCTGGTGGCGGGTGGGCGGTGGGTGCTGGACGCGGTGCGGCGTGAGCTGGTCGG
TGACGGGACGCCCGCGCTGGGCGGGGTGGTGGAGATCGAGCTGGTGCGGCGGCGGGACCGGTTGTCGCCG
GGGTACCGGGAGTTCGGGGACGTGCTGGCGGAGCTGGAGGTGGGGCACGTCGGGGCGGCGCTGGTCGAGC
ACGCGGGGCGGCTGGGGTTGCGGGCGGAGGTCGACGGGGTGGTGGTGCGGGTGTCCTCGCACCGGGAGAG
CGGTGAGGCCGTCGCGCCGTCGCCGGTTCGGAGCTCCGGGGTGGGGGCGCGGGGCATCGCGGCCGATCCG
AGGCCGCTGCCCAAAGCTGTGCTGGACGCGGTGGTGGGTGCGGTGGGGCGGTCGTCGGGTGGGGTGCGGC
ACCGGTTGGCGGTGCGCGGGGTGCGGGACGTCGTCGACGGCTGGTACGCGGTGGACGGCGGGCTGCGGGT
GGTGGAGCCGGGGGACGCGGTGCGCTCGTTGGGGGCGGTGTTCGGGCACCCGCCGGGGGTGTTCGACGTG
GCGTCGGCGAACCTGGCGCTGGTCACCACGGGTGATCCGGCGGAGGCGGTCGCGGCGAGCGGGCCGGACG
GGTACCGGGGGCTGCTGCGGGCGGCGGGGGTCACCGGGCAGCACGTGTGCGAGGCGGCGGCCGGGGTGGG
GGCGTTCTGCCGTCCGGCGCGGAGCGTGGACGACGGGGCGCTGGAGGGGCTGGTCGGGGCGCCTGCCGGG
CACTGCTTGCTGTACCTGCTGGTGATCGGGCGTCCGCGTGGGGCGGGGTTCGCCTACGACCTGAGTCCGG
TGGAGGCGTGA
 Primer design

Protein Sequence:376 a.a.
>Amir_3865|ThioFinder485 Actinosynnema mirum DSM 43827
MGVGGARGGSGVGDERAALAEAYAHGPGRVVEPGVSPAVAAAAGARIPLRALAGCGRFGAAVAHLVTAVA
TPLRWEPWNQYNDHRAYPSARAAHTVDLVLVAGGRWVLDAVRRELVGDGTPALGGVVEIELVRRRDRLSP
GYREFGDVLAELEVGHVGAALVEHAGRLGLRAEVDGVVVRVSSHRESGEAVAPSPVRSSGVGARGIAADP
RPLPKAVLDAVVGAVGRSSGGVRHRLAVRGVRDVVDGWYAVDGGLRVVEPGDAVRSLGAVFGHPPGVFDV
ASANLALVTTGDPAEAVAASGPDGYRGLLRAAGVTGQHVCEAAAGVGAFCRPARSVDDGALEGLVGAPAG
HCLLYLLVIGRPRGAGFAYDLSPVEA