Home 

Gene Symbol:  
Amir_3864
Organism:  
Actinosynnema mirum DSM 43827
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4529109..4530809 [1], 1701 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003101589.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1701 bp
>Amir_3864|ThioFinder484 Actinosynnema mirum DSM 43827
GTGAGCGACGTCGAGGTCGTGGAGCTGACCGGGTACGCGCTGGGCGAGCTGGAGCGGCTCGGGGTGGACG
GGCCGGTGCTGCCGGTGCGGTTCGACGGCGCGCTGGTGCTCGTGGGGCCGGTGCTGGACGGGAGCGGGGT
GTGCCTGCGGTGCGCCGAGGACGCCCGGCTCGCGGCGCTGGGGGCGGTGGTGCCGCGTGCGGACCCGGCG
ATGCGGGTGGGTGGTCTGGTCGTCCCCGCGCTGCGGCCGGTGCTCGACGCGCTGGTGGAGCGCGTGCTGG
CCGATCCCGGCGCCCATCGTGATCGGGTGCTGGCCCTGCGGTCGGACCTGGGCGCGGTTGGCGAGCACCG
GGTCCGGCCGAGGCCCGAGGGGTGTGCGAGGTGCGGGCCGCTGCCCGAGGACTCGGCGGAGGCCGCGAGC
GTGGTGCGCGCGCCCGTGCCGGTGGAGCCGGGGTCGTTGCGCGGTGAGAACGCTGCGACCGCAGGGGATT
CGGTGCGCCGCGAGCTGTTCGACCTGCGGCACGGGCCGGTGGGTGGGCTGCACCGGATCGGGGACCTGGT
CGTGGCGGCGGTGAGCGCCGAGCTGGTGGGCGGGCAGGCCGGGTTCGGGCGCACGGGCGATTACGAGCAC
GCCGAGCGGGTGGCGCTGTTCGAGGCGGTGGAGCGGCACGCCGGTCTGCGGCCGAGGCGGGTCACCACGG
TGGTGGAGGCCTCGTTCGCCGAGCTGGGGCCCGACCGGGCGCTCGACCCGGTGCGGTTGGGGTTGCCCGA
CCTGGAGTCGCCGCACGTGACGCCGTACCGGCCGGACGTGCGGATCCGCTGGGTGCACGGGTGGTCCTAC
ACGCGGGGGCGGGCCGTGGCGGTGCCCGAGCACGTCGCCTACTGGGGGCGGGCGATCGGGCCGAGGTTCG
TGGACGAGACGTCCAACGGGTGCGGCACGGGCAACAGCCTCACGGAGGCGGTGCTGCACGGGCTGTTCGA
GGTCGCCGAGCGGGACGCGTTCCTGACCGCCTGGTACGGGCGGGTGCCGTTGCCGTCGCTGCGCTCGGAC
GACGGGCTGACCGCGCACGTGGCGGACCGGTTGGAGCAGGTGGGGTATCGGCTGGAGCTGTACGACGCGA
CGAACGACCTCGGGGTGCCGTCGGTGCTGTCGTTGGCCCGGCGGGTGGAGGGGCGGGGTGGGTTCCCGTG
CGCGTTCTACGCGGCGGGGGCGGGGTTGGACGTGGAGGCGGCGGTGCGGGCCGCGGCGGCCGAGGTGGTG
ATGGACGTGGAGGCGGGGGCCAAGCGGTACCGGAGCGAGCCTGGGGACTACGAGCTGGAGCGGTTGCGGC
GGATGCTCCGCGAGCCCCGGCTGGTGCGGACGATGGACGACCACGTGAACGTCAACGCGTTGCCGGAAGC
GTTGGGGCGGCACGACTTCCTGGTTCCGGGGCCGGGGCGGGAGCTGGTGGCGCCGGACGTGCCGAGCGGT
GATCTCGACGCGCTGCTGGAGCACTACGTGCGGCGGTGGGAGGCGTTGGGGCTGGAGGTGATCGCGGTGG
ACCAGAGCGATCCGGTGGTGCGGGAGCGGTTGGGGTTGTGCTCGGCGAAGGTGATCGTGCCGGGGGCGGT
GCCGATGACGTTCGGGGAGGTGAACCGGCGCACGGGTGGCATACCCCGGCTGCGCCTGTCCGGTCCCCCG
CTGCCGCACCCGTTCCCGTGA
 Primer design

Protein Sequence:566 a.a.
>Amir_3864|ThioFinder484 Actinosynnema mirum DSM 43827
MSDVEVVELTGYALGELERLGVDGPVLPVRFDGALVLVGPVLDGSGVCLRCAEDARLAALGAVVPRADPA
MRVGGLVVPALRPVLDALVERVLADPGAHRDRVLALRSDLGAVGEHRVRPRPEGCARCGPLPEDSAEAAS
VVRAPVPVEPGSLRGENAATAGDSVRRELFDLRHGPVGGLHRIGDLVVAAVSAELVGGQAGFGRTGDYEH
AERVALFEAVERHAGLRPRRVTTVVEASFAELGPDRALDPVRLGLPDLESPHVTPYRPDVRIRWVHGWSY
TRGRAVAVPEHVAYWGRAIGPRFVDETSNGCGTGNSLTEAVLHGLFEVAERDAFLTAWYGRVPLPSLRSD
DGLTAHVADRLEQVGYRLELYDATNDLGVPSVLSLARRVEGRGGFPCAFYAAGAGLDVEAAVRAAAAEVV
MDVEAGAKRYRSEPGDYELERLRRMLREPRLVRTMDDHVNVNALPEALGRHDFLVPGPGRELVAPDVPSG
DLDALLEHYVRRWEALGLEVIAVDQSDPVVRERLGLCSAKVIVPGAVPMTFGEVNRRTGGIPRLRLSGPP
LPHPFP