Home 

Gene Symbol:  
Amir_3862
Organism:  
Actinosynnema mirum DSM 43827
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4526468..4527556 [1], 1089 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003101587.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1089 bp
>Amir_3862|ThioFinder482 Actinosynnema mirum DSM 43827
GTGATCGACGTCGTCTGCCACTACCGCGACCCGGTGAAGGCGCCCCTGCTGCGCGACGCCGTGCTGCCCG
CGCTCGCGGCGGCCGTCGACGCGGGCGCGGTGGGGCACCTGGAGCGGCACTGGTTGCGGGGGCCGCACGT
GGTGGTGCGGTTGGACGGTCCGGACGGGGTCGTGGGGCAGGCCGCCGAGCTGGTCGCCGGGCGGTTGCGG
GCGCACCTGGTCGAGCACCCGTCCACTGTGGACGTCACGGACGGCGAGCTGCTGGAGCGGTCGCGGCAGA
GCGGGATCGCGGAGCTGGTGCCGCCGCCGTACGGGCCGATCCAGCCGGACAACACGGTGCTCGTCGAGCC
GACCGACCTCGCCCCGGTGCTGCGGTTGGCGGGGTCGGACGAGCTGGTGGAGCTGCGCACCACGAGCCTG
CGGTTGGGTGTTCCGGCGATCGCGGACGCGGTGGCCCTGGACCGCACGAGCCAGGGGCGGGTGCAGCTCG
CGCTGGTCGCGATGGCCGCGCACGCCTGCCGCTTCCCCGCCGGGATCGCCAACGGCTACCACTCGTTCCT
GTCGCACCTGGAGGGGTTCCTGGGGCACGGCGACCCCGGCGGGGTGCTGCGGGCGCGGTTCGACCGGGTG
TGGGAGCGCAACGCGGACGCGGCGGTGGCGGCCGTGCGCGCGGTGCTGGACGGCTCGGCCGGGGTGGTGT
GGGCGGAGTGGTCGGACGCGGCCCGCGCGCTGGGGGAAGCGGCCTTCGACCGGGGCGGGCTGCCGACCGG
GCCGACCGGGCTGCTCGGGGAGCGGGCGCTGGAGCTGGGCGAGCCGGAGGCGGTGCGGCGGTGGCACCGG
GAGCACATGGGCGAGCCGGGCGAGTACCACCGGCGGTTGATCGAGGTCGACTTCGACCACCCGGACTACC
TGCGGCCGGTGACGGTGTACCGGGCGGGGACGAACGCGCTGTACCGGTTGCTGGCGGTGTGCGACGTGAC
GCCGGTGGAGCGGTACCTGGCCGCGAGCCTGCTGGTGCGGGCGGTGCAGCGGGTGACCGGGGTGCGGTGG
GACGAGCAGGTGGCGGGGATGGCGAAGGTGGTCCGGTGA
 Primer design

Protein Sequence:362 a.a.
>Amir_3862|ThioFinder482 Actinosynnema mirum DSM 43827
MIDVVCHYRDPVKAPLLRDAVLPALAAAVDAGAVGHLERHWLRGPHVVVRLDGPDGVVGQAAELVAGRLR
AHLVEHPSTVDVTDGELLERSRQSGIAELVPPPYGPIQPDNTVLVEPTDLAPVLRLAGSDELVELRTTSL
RLGVPAIADAVALDRTSQGRVQLALVAMAAHACRFPAGIANGYHSFLSHLEGFLGHGDPGGVLRARFDRV
WERNADAAVAAVRAVLDGSAGVVWAEWSDAARALGEAAFDRGGLPTGPTGLLGERALELGEPEAVRRWHR
EHMGEPGEYHRRLIEVDFDHPDYLRPVTVYRAGTNALYRLLAVCDVTPVERYLAASLLVRAVQRVTGVRW
DEQVAGMAKVVR