Home 

Gene Symbol:  
VAB18032_21120
Organism:  
Verrucosispora maris AB-18-032
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3670434..3671504 [-1], 1071 bp
Product Function:  
putative lantibiotic biosynthesis protein
Product Locus:  
 YP_004405924.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1071 bp
>VAB18032_21120|ThioFinder504 Verrucosispora maris AB-18-032
GTGTCCGAGGGGGAGTGGACCGTGACTGACTATCCGTCGCCGGTGGACCACGGCTGGCTCAGCGTCCACG
TGTTCTACGCCAGCAACGCCAACCCGATGCTGGTGGAGGGCGTGCGGCCGCTGGTGGACGAGTTGCGTGA
GGAAGGGCTGATCAGCCGGTACTTCTTCATCAAGTACTGGATGGAGGGCCCGCACGTCCGGCTGCGGGTG
CTGCCCGCCCCGGGCGTCGACCCGCAGGTGGTGCGCTCACGGGTGGACGAGGCGATCGCCGCCTTCCTGC
GTCGCCGCCCCGCGCTGTACGAGGTGGACAGCGAAGGGCTGGGTGACCTGTACAAGCAGATGTTCCTGGC
CGAGTACGGCCAGCAGCGCTGGGACGCCGAGTACGGTGCGACCGGCAGGATGCCGATGCGGGCCAACAAC
AGCTATCACCACATCCCGTACGAGCGTGAGTACGGCCGCTACGGCGGCCCGGCCGGCATCGAGCTGGCCG
AGTGGCACTTCGAGCACTCCAGCGACGTGGTGCTGGACCTGCTGGCCACCACCAACGTGCACGTACGGCC
GGTGCTGCTGGGCCTGTCGGCGCAGCTGGGCATGATGCTGTGCGCGGTGTTCCTCGACGACGACCGCCGC
ATCGCCGAGTTCCTCGACGAGTACCGCCGATTCTGGGAGGTCTCCTACTCCGAGCCGAGCGACGACTACC
ACGCCAGCTTCGACACCAGCTATCGGCGGATGGACGCCGCGCTGCGCGACCGGCTGGCCGCCATCCGGAC
GGCGGCACGGGGCCCCGCGTCCGCTCAGGCCACCGGGGTCGAGGGTCGCTGGGCGGCGCACTGCCGTGAA
CTGCGGGACCGGGTGGTCGCGGCGGCCGGGCAGGGCAAGCTGGTCTTCCAGCGCGGCGATGCCGAGCCTC
GGGTGGTCGAGGATCTCGACGCGGTCGTACCGATCGTGCTCAGCTCGTACCTGCACATGACCAACAACCG
GCTCGGCGTGAGCATCCTCGACGAGATCTACCTGTCGTACCTGATGCGGGCCGCGCTGCTCGACGAGCCG
GCGCCGGCCGGGCCCCGATGA
 Primer design

Protein Sequence:356 a.a.
>VAB18032_21120|ThioFinder504 Verrucosispora maris AB-18-032
MSEGEWTVTDYPSPVDHGWLSVHVFYASNANPMLVEGVRPLVDELREEGLISRYFFIKYWMEGPHVRLRV
LPAPGVDPQVVRSRVDEAIAAFLRRRPALYEVDSEGLGDLYKQMFLAEYGQQRWDAEYGATGRMPMRANN
SYHHIPYEREYGRYGGPAGIELAEWHFEHSSDVVLDLLATTNVHVRPVLLGLSAQLGMMLCAVFLDDDRR
IAEFLDEYRRFWEVSYSEPSDDYHASFDTSYRRMDAALRDRLAAIRTAARGPASAQATGVEGRWAAHCRE
LRDRVVAAAGQGKLVFQRGDAEPRVVEDLDAVVPIVLSSYLHMTNNRLGVSILDEIYLSYLMRAALLDEP
APAGPR