Home 

Gene Symbol:  
VAB18032_21125
Organism:  
Verrucosispora maris AB-18-032
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3671476..3674310 [-1], 2835 bp
Product Function:  
Lantibiotic dehydratase domain-containing protein
Product Locus:  
 YP_004405925.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2835 bp
>VAB18032_21125|ThioFinder505 Verrucosispora maris AB-18-032
GTGACACCCCCGACCCACACCGACACGCCGACGAAGGAGATGCCCGTGACGGTGTCGTTGCCCGCCCCGC
CGGCCACCGAGATGTCCTGGCTGATGCCCGAGGTGTTCATGCTGCGCACCGGTGGGCTGCCCCTGGAGGT
CGCCGACCGGCTCGCCTTCGACCGCAGCGCCGCCTGGGCGAACCAGGTCGTCGACCTGGAGACGCGGCTA
CGCGACACGGGCCGGGACCTGGCCGACACGTTGCAGGCGGTGGTGGCCCGCCACCTGCACGACGACGGGC
TGCGGCAACGACTCATCCGGTTACGCCGCGACGTGTACAACCTGCGCCGGCCGCGCCCGGCCGACCCGGA
CGCCTGGGCCGACGTCCTCGACGCCGACACCCACCGCGCGTTGACCGACTGGCTGCAGACCTTCGACGCG
TACCGGCGCGGGCTCGCCGACGGCCCGGCGGTGCTGGCCGAGGAGTTGACCGAACGCCGCGCGGTGCTGC
GGGATCTGGCCGACGACCCCGACCTGCGCGGCGGAATCCTGCTCGCCTCCCCGTCGCTGGACCAGTACCT
ACCCGGCTACCTCGCCACGCCGGGCCGGCCCGGCAAACGGACCCGCCGGGTGGAGCGGTCGCTGCTGGAG
TACGCACTGCGCACCGCCTGCAAGACCAGCCCGTTCAGCCGACTGACCACCGTGAACGTCGGAACCTTCA
GCCACGGCGGCGGCCGGCTGCTCGACGTACGCCCGGCCACCGGCGCGGGCAAGACGGCGGTGGCCCGGCT
CAACCTCGCCGCGCTGGGCCGGCTTTCGGCCATCGTGCTGGCCGACGAGACGCTGCGCGCGGACCTGCCG
GTCACCGTCACCACCGGCTGGCGCATCGAACGGGGCCGGCTGCGCTACCTGCGCCGACGGCGGACCAGTT
CGGAGGACGGCGACGCGGCGATCACCCTGGAGTCCATCCACGAGTCGCTGTTCGTGCTGCCCACCGGGCA
GGTGCTGCACGACATCCTGGCCGCGCTCGACGGCGGTCGGGTCCGGCGGCTGTCCGAACTGGCCGCCGAA
CTGGCCGTCGACGGCCGTCCCGCCGACGAGGTCGGGCAGTACCTGCACCACCTGCTGCGCGTCGGTCTGC
TGGTGGTGCCGAACCTGCAACTGGACATTCACGCCGACGATCCGGTGGAGGGCTACCGGCGGGCGCTGCG
CGACATCGACCGCCCGTGGGCCGACCGGCTCGCCGACCGGGTGGCCAGCGTCAACCGCCTCGCCACCGAC
TACCCGGACGCCGACGTCGACGGCCGGCGGGCCGCGCTGGCCCAGATCCGCCAGGAGTTGCTCGCCGCCC
ACACCGACCTCGGCCGCGCCGACATCCCGGCCCCCCGGACCCTGGTGTACGAGGACGCCACCCTGCGTAC
CGACGCACCGGTCACCGCCGACCGCGACCGGTGGGACCGCACGGTGCTGCCCGGCCTGCGGGCACTGGCG
CGGATCATGCCGGTGTTCGACGTCAACCTGCCCCGTCGGGTGGTCACCAAGGGCTTCTTCCTGGCCCGTT
ACGGGGTCGGGGGCCGGTGCGACGACCTGCTCAGCTTCGCCCACGAGTTCCAGCAGGACTTCTTCGAGCA
CTACACCGGGCGGTCGATGCGCCGCCGGGCCTTCGACGCCGACAACACCTACGTCCGGCAGGAGAACTGG
TTCCGGCAGGACGAGATCACCGCCCTGGACGACGCGCGCATCGAGGTGGCCCGGCGGGTCAACGAGGCGT
ACGCCGCCCTGCCGGCCGACGCCGAGGAGATGATGCTGGACGAGACGTTCATGGCCGAGGTGGCCGCGAT
GGTGCCCGACACGCTCGGCACCCTCGACCCGCGTTCCTTCTTCCTCCAACTCGCCGACCAGGGCGACCGG
CAGCGGGTGGTGGTCAACCGGGTCTACTCCGGCATGACGCTGCTCTTCTCCCGCTTCGCCCACCTGTTCG
CCGCCGAGGATCTGGCCGGGGCGCTGCGCGCCGAGTTGGCCCGGCTCCAACCACCCGGCGCGGTGCTGGC
CGAACTGCGCGGCGGGTACGACGCCACCAACCTCAACCTGCACCCGGCGGTCACCCCCTACGAGCTGGTC
TGCCCCGGGGAGATCAGCTTCCGGCCGACCGCCGAGCAGATCCACATGGACGACCTCAGTGTCGAGCACG
ACCCGGTGGCCGACCGGCTGCTGCTGCGCTCGCGCCGGCTCGACGCCGAGGTCATCCCGGTCTACCTGGG
TTTCCTGCTGCCGATGGCGCTGCCCGAGGTGCAACAGGTGCTGCTCAACTTCGCCCACCTCGGGATGGCC
CAGCCGGATCTGTGGGCCGGCACCACGGTGCCGCTGCCCGAGGGGGGCATGGTCGGTTATCCCCGCATCG
TGCACGGCGACCTGGTGTTGCAACGGCGGATGTGGAAGCTGCACCCCGGTCACCTGCCGCCCGCGCGTAC
CCCGCAGGTCGACGACGCCGAATGGTTCCTCGCCTGGCAGCGGTGGCGGCGGGAGAACGGCCTGCCGCGT
CGGGTCTTCGCCACCCCGGAGGGCACCCGGCTGGTTCCCGCCGCCGACGACGGCGAAGCACCCGCCGGTG
GTGGCGCGGCCGGTGGTGGCGCGGCCGGTGGTCGCCCGGAGCACAAGCCGCTCTACGTCGACTTCGACAG
TTACCTGTGCCTGCAACTGTTGGAGGCGACGGGCCGCTCGGCGGGCAGCCGGCTGGTGCTCGTCGAGATG
CTGCCCGACCGCGACGAGCAGGTGGTACGCGGGGCGTCCGGGTCGTACGTGACCGAACTGACCGTGGAAC
TCAACGGTGTCCGAGGGGGAGTGGACCGTGACTGA
 Primer design

Protein Sequence:944 a.a.
>VAB18032_21125|ThioFinder505 Verrucosispora maris AB-18-032
MTPPTHTDTPTKEMPVTVSLPAPPATEMSWLMPEVFMLRTGGLPLEVADRLAFDRSAAWANQVVDLETRL
RDTGRDLADTLQAVVARHLHDDGLRQRLIRLRRDVYNLRRPRPADPDAWADVLDADTHRALTDWLQTFDA
YRRGLADGPAVLAEELTERRAVLRDLADDPDLRGGILLASPSLDQYLPGYLATPGRPGKRTRRVERSLLE
YALRTACKTSPFSRLTTVNVGTFSHGGGRLLDVRPATGAGKTAVARLNLAALGRLSAIVLADETLRADLP
VTVTTGWRIERGRLRYLRRRRTSSEDGDAAITLESIHESLFVLPTGQVLHDILAALDGGRVRRLSELAAE
LAVDGRPADEVGQYLHHLLRVGLLVVPNLQLDIHADDPVEGYRRALRDIDRPWADRLADRVASVNRLATD
YPDADVDGRRAALAQIRQELLAAHTDLGRADIPAPRTLVYEDATLRTDAPVTADRDRWDRTVLPGLRALA
RIMPVFDVNLPRRVVTKGFFLARYGVGGRCDDLLSFAHEFQQDFFEHYTGRSMRRRAFDADNTYVRQENW
FRQDEITALDDARIEVARRVNEAYAALPADAEEMMLDETFMAEVAAMVPDTLGTLDPRSFFLQLADQGDR
QRVVVNRVYSGMTLLFSRFAHLFAAEDLAGALRAELARLQPPGAVLAELRGGYDATNLNLHPAVTPYELV
CPGEISFRPTAEQIHMDDLSVEHDPVADRLLLRSRRLDAEVIPVYLGFLLPMALPEVQQVLLNFAHLGMA
QPDLWAGTTVPLPEGGMVGYPRIVHGDLVLQRRMWKLHPGHLPPARTPQVDDAEWFLAWQRWRRENGLPR
RVFATPEGTRLVPAADDGEAPAGGGAAGGGAAGGRPEHKPLYVDFDSYLCLQLLEATGRSAGSRLVLVEM
LPDRDEQVVRGASGSYVTELTVELNGVRGGVDRD