Home 

Gene Symbol:  
VAB18032_21130
Organism:  
Verrucosispora maris AB-18-032
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3674307..3675935 [-1], 1629 bp
Product Function:  
nitroreductase
Product Locus:  
 YP_004405926.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1629 bp
>VAB18032_21130|ThioFinder506 Verrucosispora maris AB-18-032
ATGCAGCTTCCGGCCCGCGACATCGTGCGGGAGTACACCGAGGCGGTCTTCCGCCGGGCCCGGGTTCCGA
TGGAACCCCTCAACTTCGAGGTGGACTGGGGCGACCAGCCCTCCCGCCACACCGCGTACCCGGCTGCCCG
CACGGTGCCGCTGCCGACGCGACTGCCCGAACTGGCCACCCTGCGTGACCTGTTCACCGGGGCGTCGCCG
TCGGCACCGACGGGCTGGTCGATGACCCGGCTGGCGGCTCTGCTCCGGCTGTCGTACGGGGTGCTCGACC
GGCGGATGACCGTCAACTGGAATCAGGACGTCGCCAAACGTGCGCACTTCGAGCACGCGGTCTGGGGGCG
GGGCACCGCCTCCGGCGGCGGCATGTACCCGGTGGAGGTGCACCTGGTGGCCGGGGCGTCCGCGCCGCTG
CTGCCCGGTGTCTACCACTACGACACCGGCCGCCATGTGCTCCAGCGGCTGCTGGTCGGGGACGTCAGCA
GCAACGTTCGAGCTGGGCTGGCCGGACCCGAGGACACCGACAGCTTCCTGGTGGCGAGCATCCGGTTCTG
GAAGAACTCCTTCAAGTACAACAGCTTCTGCTACCACGTGGTCACCCAGGATCTCGGTGCGCTGCTCGGC
TCCTGGGAGCTGCTGGCGTCGGCGCTGGGTGTGCCGCTGCGTCGGCTGCTCTGCTTCGACCCGGAGCCGA
TGGACCGGCTGCTCGGGTTCGACAGTGACGAGCAGAGCGTCTTCGCGGTCGTGCCGTTGAGCTGGCACAC
CGACACCGGGGCCGGTGACCCCGCCGTGCCCACCCGGGCCGGGGACGGCGAGGTCACGCCGGCAACCGTC
CAGGTCGGCCACGCCGCGCACGAACGCTCCCAGCGGGTGCGGCGGTTCCCGGCCGTGACCGCGGTGCACC
GGGCGGCGGCCACCGCGCCGGCGGTCGACCCCGCCGCGGTGCTGGACGCCGCACCCCGGCCACTGCCCGG
CGATCCGGTCGCACTACCCGAACCCCGCCTCGACCTGCTCGACCGGCCCCTGTCGGCGGTGCTGACCGGC
CGGTCCAGCAGCTTCGGCCGGTTCCGACGGCCGCCCGAGCTGACCGTCGCCGAACTCGGCACCACCCTCG
CGTTCGCCGCCGCCGGCCGCCCTCACCCGGCCGACGCCGGCCTACCCGCCGACGCTGCGGCGCTGACCCG
GCTCTGGGTCTTCGCCAACCACCTCGACGGGCTGCCCGCCGGCGGCTACGCCTACTGCGCCCGGCGACAC
GCGCTGCTGCCCGCCGCGTCCGAACCCGACATCGGGATGTCGGCGTTCCTGCAACAGCAGTACTTCCTCA
CCAACTACACCATGGGACAGGTCGGCGCGGTGCTGGCCGTCTCCGGACGGCTCGACGCCGTGCTCGACGC
GTACGGTCCCCGGGGTTACCGGATCCTCAACGCCGAGATCGGCGCGGTGGCCCAGCGGGTGTACTGCGCC
ACGACCGCCCAACGGGTCGGCTGCGGGGCGGTGCTGGGCTTCGACAACGTCTCCATGGACACCGCGCTCG
GGCTGGACGGCAGCGACGAACGGACGGTGCTGTTCCTGCTCCTCGGCCGCAACTCGGACGCCGTCGCCGA
CCTGGAGTACCGGCTGTGA
 Primer design

Protein Sequence:542 a.a.
>VAB18032_21130|ThioFinder506 Verrucosispora maris AB-18-032
MQLPARDIVREYTEAVFRRARVPMEPLNFEVDWGDQPSRHTAYPAARTVPLPTRLPELATLRDLFTGASP
SAPTGWSMTRLAALLRLSYGVLDRRMTVNWNQDVAKRAHFEHAVWGRGTASGGGMYPVEVHLVAGASAPL
LPGVYHYDTGRHVLQRLLVGDVSSNVRAGLAGPEDTDSFLVASIRFWKNSFKYNSFCYHVVTQDLGALLG
SWELLASALGVPLRRLLCFDPEPMDRLLGFDSDEQSVFAVVPLSWHTDTGAGDPAVPTRAGDGEVTPATV
QVGHAAHERSQRVRRFPAVTAVHRAAATAPAVDPAAVLDAAPRPLPGDPVALPEPRLDLLDRPLSAVLTG
RSSSFGRFRRPPELTVAELGTTLAFAAAGRPHPADAGLPADAAALTRLWVFANHLDGLPAGGYAYCARRH
ALLPAASEPDIGMSAFLQQQYFLTNYTMGQVGAVLAVSGRLDAVLDAYGPRGYRILNAEIGAVAQRVYCA
TTAQRVGCGAVLGFDNVSMDTALGLDGSDERTVLFLLLGRNSDAVADLEYRL