Home 

Gene Symbol:  
VAB18032_21135
Organism:  
Verrucosispora maris AB-18-032
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3675946..3677904 [-1], 1959 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_004405927.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1959 bp
>VAB18032_21135|ThioFinder507 Verrucosispora maris AB-18-032
ATGATCGTCGACGTCCGGACGACCTCCACCGGATGGGACAGCAGCCTCAAGCAGCTCGGTGAGGTGCTCC
ACGAACGCCGCCAGGACCGGCCGCCCGCGCCGGGCCCGACGCCGCTGGACGGCCTGACCGTCCGCATCGC
CGCGCTGGGGCTGATCGACGCCAACCGCGACAGCGCCGAGACGGTGTCCGGCGGCGACGTCCTGCCGGTC
TGGTTGTCCAGCGCCACCGCGCTGGTCGGCCCACGCTGGTCGCCGCCGACCCAGGGGGAGCACGTCGGAC
CCTGCCCGCTCTGCGTGCAGCGTCGCTGGCAGGCCATCCGGGTACGCGAGGAGCGTCACGCCCTGGAGCA
CGGCGCCCGAGTCGGCACGGTCGGCGCGCTGCCGCACCTGACCCCGTTCGCCGTCGACGCCCTGTGGCAA
CTCCTCCTCACCGCCGCCGACTCGCCGCCCGACCGGCCGGGAGTGGGCCGCCTCTGGCAGCTGCGCATGG
ACACCCTGGAGACGACGACCGTGGCGGTGCTGGTCGACTCCGAGTGCCCGACCTGCGCCCGTCCCGTACC
GGACACCGCCGAAGCGGCGGTCATGCCGCTGACCAGCCGCCCCAAGCCGGATCCGGAGTCGTACCGGCTG
CGGTCGGCCGGGGAACTGGACCTGCCGGTGACGGCGCTGGCCAACCCGCTCGTCGGTGCGCTGGGCGGCA
ACGCGCTGCGTGCCTACAATGCCACCGCCACCGCGCCGGTGACCGGCTACTTCCGGGTACGCAGCCGCTA
CGACCTGCACGAGATGTGGTGGAGCGGGCACGCCAACAGCTACGGCAGCAGCGAGACGTACGCGCTGCTG
GAAGGGCTGGAACGGTACGCCGGCCAGTTCCCCCGGGCCAGGACGACCACGGTCTTCGACAGCTACACCA
ACCTCGCCCCGCACGCCCTCGACCCGGCCGGCCTCGGCTACCACCCGGCGTTCTACCACGGCCACGGGCT
CTACTACGCCCCGTACTCGCCGACCGAGCCCATGCACTGGGTCTGGGGCTACTCGTTGCGGGACCGGGCA
CCCCGGCTGGTCCCCGAGCAACTGGTCTACTACCTGGACCGGCGTACCGACCAGCGCAAGTTCGTCCAGG
AGTGCTCCAACGGCTGCGCCAGTGGCAGTTGCCTGGAGGAGGCGCTGCTGCACGGCATGCTCGAACTGGT
CGAGCGGGACGCCTTCCTGCTCGCCTGGTACGGCTCCGCGCGGCTGGCCGAGATCGACCCGGCCACCTGC
CGCGACGAGCGGGTGCACTTCATGATCGACCGGGTGAACCTGCTCGGGTACGACCTGCGCCTGTTCGACA
CCCGCGCCGACCTGCCCGTCCCGGTGGTCACCGCGGTCGCCGTCAAGCGGGGCGACGGGCTCGGGCAGCT
CTGCTTCGCCGCCGGGGCCAGCCTCGACCCCGACGACGCGGTCCGTGCGGCGGTCTGCGAAACCGCGTCG
TACGTGCCCGGGTTCGACGAGCGGGTGGCCGCCAGCGAGGCGGAACTGCGGGAGATGACCCGCGACTACA
CCAAGGTCACCGAACTCAGCCACCACGCCCTGCTGTACGGCCTGCCGGAGATGACCGACCACGCCCGGTT
CCTCTTCGACAACCCGCCGCTGCGGTCGATGACCGACCTGTACGGCGACTGGTTGGCGACCCGACCCACC
CACGACGACCTGTGGGCCGACACGGAGTACCTCGGCGGCCTGATCGCCGGGCTGGGCGGTGACGTCGTCG
CGGTCGACCAGACCTGCCCGGAGCAGGAGATCGCCGGGGTGCACACGGTGGCGGTGGTCGCCCCTGCCCT
GGTGCCGATCGACTTCGGCTGGCAGCGGCAGCGGGTGCTCTACAGCGACCGGCTGGAGCGGCACCTGGCC
CGAGGCACGCACGGACCGGACCGGCTCGGTGCCACCGGTCGCAACCTGAACCCGCACCCCTTCCCGTAG
 Primer design

Protein Sequence:652 a.a.
>VAB18032_21135|ThioFinder507 Verrucosispora maris AB-18-032
MIVDVRTTSTGWDSSLKQLGEVLHERRQDRPPAPGPTPLDGLTVRIAALGLIDANRDSAETVSGGDVLPV
WLSSATALVGPRWSPPTQGEHVGPCPLCVQRRWQAIRVREERHALEHGARVGTVGALPHLTPFAVDALWQ
LLLTAADSPPDRPGVGRLWQLRMDTLETTTVAVLVDSECPTCARPVPDTAEAAVMPLTSRPKPDPESYRL
RSAGELDLPVTALANPLVGALGGNALRAYNATATAPVTGYFRVRSRYDLHEMWWSGHANSYGSSETYALL
EGLERYAGQFPRARTTTVFDSYTNLAPHALDPAGLGYHPAFYHGHGLYYAPYSPTEPMHWVWGYSLRDRA
PRLVPEQLVYYLDRRTDQRKFVQECSNGCASGSCLEEALLHGMLELVERDAFLLAWYGSARLAEIDPATC
RDERVHFMIDRVNLLGYDLRLFDTRADLPVPVVTAVAVKRGDGLGQLCFAAGASLDPDDAVRAAVCETAS
YVPGFDERVAASEAELREMTRDYTKVTELSHHALLYGLPEMTDHARFLFDNPPLRSMTDLYGDWLATRPT
HDDLWADTEYLGGLIAGLGGDVVAVDQTCPEQEIAGVHTVAVVAPALVPIDFGWQRQRVLYSDRLERHLA
RGTHGPDRLGATGRNLNPHPFP