Home 

Gene Symbol:  
Francci3_4200
Organism:  
Frankia sp. CcI3
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5014658..5015668 [1], 1011 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_483277.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1011 bp
>Francci3_4200|ThioFinder530 Frankia sp. CcI3
GTGAACCGTACGATCGCTCCCGGCAGCCCTGTCCGAGCCGGAGACGTCCCGACAACCTGGCGGTCGTGGC
ATCTGCACCTGGGGTCCGTGGCCGGATCCCTTCATGACCGCGTACTCGGCGAGGTGATCGGCCCCACCGT
CGACGACGTACCTGGCAAACCGTGGTTCTTCATCCGCTACTGGCAGGCTGGTCCACATCTCCGGTTCAGA
GTCGGCGACTTGGACGACGACGAGGCGCAACAGGTCGAACAGTCCCTGCGGGAGCGGCTCGCGCGTGCCG
GGACGCTGCGCGATGGCGAGGAGCCTCTCGACGCGGAGAGCCACCGGACCGCCGCTCGGCGTCTGGCTGC
CACCGGCGGCGAGGCTGAGGACACGGCTGGGGGGCCGCTGCCGCCGGGAGTCCACCGCGCGGTGTTCGTG
CCCGAGACCGAGCGGTACGGCGGGGCAGCGCTGATGCCTGGTGCGGAACGGCTCTTCCAGGTCTCCAGCG
AGCTGGTCAGAACACATCTGCCGAGCCTGCCAGGCACCCGGGAGCGGTCGGCCGTCGCACTCCGGGCCAC
GGTGTCGGCGGGCGCTGCGCTGGGCGGACGTGGCGAGCAGGCCGACTACTACCACCAGGCGCTGCACGCC
TGGCGCGGCATGGTGGCGGCCGGATTCGGCTACTCCGAGCAGCAGTTGGATCGACTCACCGGTGCGGACC
GCCCGGCGCTGTCCACGGCGGGGGCATCGCGACGCGGGAGCATCGACCCCGAGCGCCACGGTGCTTTCGC
CCTGTGGCACCGCCTCCTGACCGAACTCGCCGACACGGTACGCGCAACCGGCACGACCCACCCGGGCCGC
ATCGTGCTCTCCCACGTCCACATGTTCCACAACCGTCTCGGCCTGAGTCTGGTCGACGAACTGCAGACGT
ACGCGCGGCTCGTCCGGCTCTTCCCCCTGGACGCTCCCGTCGGCGGCCCGTCCGGCACGCCTGCCGCCCC
CGACCCGCATCGCAGCGCACACGAGGGGTGA
 Primer design

Protein Sequence:336 a.a.
>Francci3_4200|ThioFinder530 Frankia sp. CcI3
MNRTIAPGSPVRAGDVPTTWRSWHLHLGSVAGSLHDRVLGEVIGPTVDDVPGKPWFFIRYWQAGPHLRFR
VGDLDDDEAQQVEQSLRERLARAGTLRDGEEPLDAESHRTAARRLAATGGEAEDTAGGPLPPGVHRAVFV
PETERYGGAALMPGAERLFQVSSELVRTHLPSLPGTRERSAVALRATVSAGAALGGRGEQADYYHQALHA
WRGMVAAGFGYSEQQLDRLTGADRPALSTAGASRRGSIDPERHGAFALWHRLLTELADTVRATGTTHPGR
IVLSHVHMFHNRLGLSLVDELQTYARLVRLFPLDAPVGGPSGTPAAPDPHRSAHEG