Home 

Gene Symbol:  
Francci3_4196
Organism:  
Frankia sp. CcI3
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5006870..5009431 [1], 2562 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_483273.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2562 bp
>Francci3_4196|ThioFinder526 Frankia sp. CcI3
ATGACCGTACAGCAGGCGGAGTCGACCGCCACGTCCCCTGCCACACCCGCGGCAGGAGCCCTCGAGCCCC
TGTGGGTGCTGCGCGTCAACCTGCTGCGCCGCACCCGGCTGAGCGACCCCGCGCTGGCCGCAGTGCTTGG
TGACCTCCTTACCGCCGAAGCGACACTCGCGGCAGCGGCGCAGAAGTGCTCCGACGAGCTGCACGAGCTG
ATTGGCGCCACTACCGACCGCGAGGCACGCGGCCGGCTCATCGCATTGCGCCGAGACGTTCACAACGACC
GCCGGCCGCGTAGCGGCACGGCCGTTACGCCAGCGGTGGACCAGTGGGCGGCGGCGCGGGACCGGCGCGA
CGCACTGCGGGCACGGATCGCGGACACCTATCCACAGGCCATCGCCCGGGAGCGGGAGGGGCTGGGTGCC
CTGCTCGCCGACGACGACCTGCGCCGCGCACTGGCCCTGGTGGCGCCCGAGGTGTCGGACGGCGCCGATC
GGTATCGCGCCGCACTGGCGGATTCACGTCCGCTGCCCGCGCGACTGCGCAAGTCGGAGCGTGGTCTGGT
GCAGTACGTCACCCGGGCCATGATTCGCACCAGCCCGCTCTCCCGCTTTACCGCCGTAGGCGTGGCGGTG
CCCGATGACCGGGGTCGGGCCCCCGACGAGATCCGCTTCGCGAGCGCCGTCCCCTTCATGGGGCTGGACC
GGGTGATGCTCGGGTATGTTGCTGCCGGGCTGACCGCCCCGAGGGACGGCGTCGGGCTGGACCACTGGGT
CCAGCTCCCACCGACGGCCGAGGTCGACGAGTCCTCCGCCCGGCTGTACTTCATGCGCCCCACGGCGAAG
GGCATCCAGCGGCTGTCCACACCGGTGACAGGCCTTGTGCAGTCGGTCCTGGAAGCCACGGCCATGGGCC
CCCGCCGTGTCGGCGCCATCGCCGGCCACATCGCAGAGCGGACGGAAGTCCACTACGACCAGGCGGTGCG
AGCCATAGCACAGGCCGTGGGCGCGGGTATCCTGTGCACGTGCGACGGGCCGGAGGACGGGGACGCGCCC
TACTCAGCGCTTCTCCACCGGCCCGACAGCCCGGTCGTCCGTCTTGACGATGTGGCCCGGCGGTTGAAAG
TCATCGCCGACGCCCCGCCGGAGGACCGCGTGGCCGAACTGAGCCGACTGAGGAGCGCGCTGGCGGACGT
CAGCCGTCATGCGGGTCGACCCGCGCAGATCCTCGTCGAGGAGGACTACGTCCTGCCGCCCCGGACAGTG
GCCACCGTTGCCTGGCGCGACCGGCTCAATGACCTTGCCGCCGGCGTCGAACTGCTGTCAGTCTTCGACC
GGCTCCACGATGTCCGTGCCCTGTTGTCCGCCGTGTTCGTGGAACGGTTCGGCCGCGGAGCCGTCGTTCC
TCTGGCGGAGCACGCGGCGTACCTGGTCGCCGAGGTCTACCGGCACAACGGAGCCGTCGACGGCAAGGTA
CCCCCTGGTATCGGCCCGGCCGACGGCTCGCTCGACGAACTCCAGGTTCTGCGTCGACACGTCCTGGACA
AGCTCTACGCTGACATCTCCCGAAGCGATACCGAGGAGGTGGTCTGGAGCCCCGGGCACGTGCGTGCACT
GGCCACCGGACTGCCCGCACGGTTCCGTGCCGCACCACTGGCGCACAGCGTGCTCGTGCAATCCTGGAAC
GGGCACTTGGTGTTCAACGACGCATACGCCGGGCACGGCATGCTCTATGGCCGGTTCCTCGGCCCGGACC
GGGACCTGGGCGGTGCCGCACTGCCCCATCTTGCCGAGCGGCTGCGACGGCAGTACGGCACGGACGGCCA
CCGGCTCGTTGAGGACCTCGGTCTGCACCGTCTCAACGTCAACGCCCACGCACCCGTCCTGTCCGACGGC
CTGGTCCCGGACGACTGGTTCACCTTCCGGCTCGCCCATGACCCGGACACCGACGGTCTCACCGTGCTCG
ACGCGGAAGAACGGCCCACCCGTGTCCTCACCCTCGGCGCCGGGCACCCCGAACTGTTCCCGCCACCCGT
ACGGGTGGCTACCTGGCTCGTCAGCGGTGGACGGCTGATGGAGGACCTAATCGGTGGCTGGCACTCGACG
ACCGGATGGGACGGCGACTCGAGCCGGCCCTGTCCCCGGCTGCGCGTCGGTTCCGCCGTACTCTCCCGGC
GCCGGTGGTACGGCGGCCGGGAAATGGCTGATGCCGTCGCGGCCGGGCCCGCCGAACATGACCGCCTGCT
GGCCCTCACCAAGTGGCGTGCCCGCCACTGCATTCCGGCGGAGATCGTCCTGAAGACCCCCCTGGACGAC
GGCTACCGCCGCGAGGCCATCGCCTCGGGCGAGGACGCCCAGGCCCACCGGCAACGGCAGAAGCCGCAGT
ACGTGGACTTGCAGAGCGCCCTGAGCGTGCGGGTGCTGCCCAGGCTCATGGAACGGCGCAGCCCCGGATA
CCTGGAGGAGGCCCTGCCGGGCGTCGGGGACGGCCCGCACGCCGCCGAGTGGGTCATCGAGATCGGGCGC
CCAGCGGGCGGAACGTTCCAGTACGGAGGAATGCCGGAATGA
 Primer design

Protein Sequence:853 a.a.
>Francci3_4196|ThioFinder526 Frankia sp. CcI3
MTVQQAESTATSPATPAAGALEPLWVLRVNLLRRTRLSDPALAAVLGDLLTAEATLAAAAQKCSDELHEL
IGATTDREARGRLIALRRDVHNDRRPRSGTAVTPAVDQWAAARDRRDALRARIADTYPQAIAREREGLGA
LLADDDLRRALALVAPEVSDGADRYRAALADSRPLPARLRKSERGLVQYVTRAMIRTSPLSRFTAVGVAV
PDDRGRAPDEIRFASAVPFMGLDRVMLGYVAAGLTAPRDGVGLDHWVQLPPTAEVDESSARLYFMRPTAK
GIQRLSTPVTGLVQSVLEATAMGPRRVGAIAGHIAERTEVHYDQAVRAIAQAVGAGILCTCDGPEDGDAP
YSALLHRPDSPVVRLDDVARRLKVIADAPPEDRVAELSRLRSALADVSRHAGRPAQILVEEDYVLPPRTV
ATVAWRDRLNDLAAGVELLSVFDRLHDVRALLSAVFVERFGRGAVVPLAEHAAYLVAEVYRHNGAVDGKV
PPGIGPADGSLDELQVLRRHVLDKLYADISRSDTEEVVWSPGHVRALATGLPARFRAAPLAHSVLVQSWN
GHLVFNDAYAGHGMLYGRFLGPDRDLGGAALPHLAERLRRQYGTDGHRLVEDLGLHRLNVNAHAPVLSDG
LVPDDWFTFRLAHDPDTDGLTVLDAEERPTRVLTLGAGHPELFPPPVRVATWLVSGGRLMEDLIGGWHST
TGWDGDSSRPCPRLRVGSAVLSRRRWYGGREMADAVAAGPAEHDRLLALTKWRARHCIPAEIVLKTPLDD
GYRREAIASGEDAQAHRQRQKPQYVDLQSALSVRVLPRLMERRSPGYLEEALPGVGDGPHAAEWVIEIGR
PAGGTFQYGGMPE