Home 

Gene Symbol:  
Francci3_4198
Organism:  
Frankia sp. CcI3
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5011160..5013094 [1], 1935 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_483275.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1935 bp
>Francci3_4198|ThioFinder528 Frankia sp. CcI3
ATGCCTGAGCCCTCCAAGGTCGCCTTCGCCCTTCCCATACCGGCTCTTGTGCGGGTGCGCGGAGCGATCG
ACGAGGCCTGGCACGAGGCGCTCGCCGACCTTCCGGACGCTGTGGGCAGCACCGTGTCCCTGGGCATCGG
GTGGGACCTCGCCTGGGAGCGCGAGCAGTGGCGATCGGCTGTCGAGGACAGGCGCAGCCACCTCTCCGTG
CGCCTGTACGCGGACGAGACTCTGATCGGCCCCCTGTGGGCGCCCGCGACCGATGCCGGATGCAGCGGAT
GCGCCGAGGTCCGCTCCCGGGTGGTTCGCGCCCACCCGATGGTCGAGGCACTGCAAGTGCCCACCGAGGT
CCCGCTTCCTCGGTCTCCCCTGCTGCCAGAGCTGCTGGCGGCCGCCGTACAACACCTCACCGCCCAGCCT
CTCGGGCCCGGTGAGCTCTACGCGGTCGGCACCGGGTCAACCCGCCGCCACCGGGTTCCACGCAGCTCCG
GCTGCCCTCTGTGCGGCGCCCGCACCACTGGCACCGCAACCGCTCCCCCGCCCGGCAGGCTGGTGCTGCA
CGACCACCCGGCGGACCCTCACGACCCCACCCGGGGCCTCACGGGCCGCCGGTTGCTCGCCCCCGGCGCC
CTGCGCCGTCGTACCGTCGACCCGCGGTTCGGCCCAGTACGGGAAGTCGTCCGCGAGTCGCGCGCCCCCT
ACGCGATGAGCATGGCGGCACTGCCCAACGCACCCGCCATGGGATACGCGCGGGCCGTCGACTTCGAAAC
GGCCGAACCGGTCGCGGTCCTGGAGGCTTACGAGCGGCTGGGAGGCTTTCCGTACGAGGCTTCGGTGATC
GAGGACGTGGCCTACCAGGAGGTCGCAGAACACGCCGTGGATCCCGCCTCACTCGGCGGGTACACCGCGC
AGCAACTGGCCCATCCGAGCACTCGCGTGACCCCGAGCTTCCCGTCCACGCCCATGGACTGGGTCTGGGG
CCACGACCTCGCCACCGGCAGACCCCTGCTTGTCCCCGCGGACATCGGCTTCTACCAGTACGACCACCGC
TTCAAACGCTCGCACCATGCCGCGCAGCGAGCCGCCCCGCACGACCGTCGCCGCTATTTCCACGACTCGT
CGAGTGGCTGCGCGCTGGGCGGAAGCCTGGAAGAGGCGGCACTGCACTCACTGTTCGAACTGGCCGAACG
CGATGCCTTCCTCATTGCCTGGCACTGTGCCGTCCCGCTGCCCGCCATCGACCCGGCCTCCATCACCGAC
CCGGCCAGCCGTCGGTTGCTCGACCTGATCGACTCGCGGGGGTTCGACGCCCATCTGCTGGTCGCCACCC
AGGACATCGACCTACCCGTGGTGTGGGCGCTCGCCATGAACCGTGAGCGGCACTTCCCGGCCACCTTCTC
GGCCGCCGGGTCTGGCTGCAATCCGGCGTCCGTGGTGCGCAGTGCCCTGTGGGAGCTCGGCCAGATCGTC
ACCGACCCGGTCACCTGGACCAGAGCCGACATCGAGCCCATGCTCGCAGACCCCTGGCTGGTCGAGGAAC
TCGACGACCACCTGCGGCTCTACACCCTTCCTCAGACGCTCGGACGGGTCACCCCGGTGCTTGGTGGTCT
GCGGGTCCCTCTCGACGAAGCGTTTCCCGGATGGCCCGACCGGCTGCGCGAGGAGGCGAAGGGCAGCGTG
CTCAGGGCGCTGCGAGCCATGCAAGAACGTTTCGCCCGCGCCGGTCTGGACCGGATCGTGCTGGTCGACC
AGTCCACCCGGGAACACCGGGACCTTCAGGTCGCCGTCGCCAAGGCGGTGGTGCCGGGAATCATCCCCAT
GTGCTTCGGCCACGCGCAGCAGCGGCTGCTGGGCCTGCCCCGGCTGACCGCAGCGCTCGCGGGCACGCCA
ACGGCCGACCGGCCCTGCCCTTATGACCCTCATCCGTTCCCGTGA
 Primer design

Protein Sequence:644 a.a.
>Francci3_4198|ThioFinder528 Frankia sp. CcI3
MPEPSKVAFALPIPALVRVRGAIDEAWHEALADLPDAVGSTVSLGIGWDLAWEREQWRSAVEDRRSHLSV
RLYADETLIGPLWAPATDAGCSGCAEVRSRVVRAHPMVEALQVPTEVPLPRSPLLPELLAAAVQHLTAQP
LGPGELYAVGTGSTRRHRVPRSSGCPLCGARTTGTATAPPPGRLVLHDHPADPHDPTRGLTGRRLLAPGA
LRRRTVDPRFGPVREVVRESRAPYAMSMAALPNAPAMGYARAVDFETAEPVAVLEAYERLGGFPYEASVI
EDVAYQEVAEHAVDPASLGGYTAQQLAHPSTRVTPSFPSTPMDWVWGHDLATGRPLLVPADIGFYQYDHR
FKRSHHAAQRAAPHDRRRYFHDSSSGCALGGSLEEAALHSLFELAERDAFLIAWHCAVPLPAIDPASITD
PASRRLLDLIDSRGFDAHLLVATQDIDLPVVWALAMNRERHFPATFSAAGSGCNPASVVRSALWELGQIV
TDPVTWTRADIEPMLADPWLVEELDDHLRLYTLPQTLGRVTPVLGGLRVPLDEAFPGWPDRLREEAKGSV
LRALRAMQERFARAGLDRIVLVDQSTREHRDLQVAVAKAVVPGIIPMCFGHAQQRLLGLPRLTAALAGTP
TADRPCPYDPHPFP