Home 

Gene Symbol:  
Francci3_4195
Organism:  
Frankia sp. CcI3
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5005749..5006873 [1], 1125 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_483272.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1125 bp
>Francci3_4195|ThioFinder525 Frankia sp. CcI3
GTGACTGTCAAGACAGCAGAACCCAAGGTCCCGCCGTCGGACGACACGGTGACCGGTCTACGCCTCTTCA
CCCGCGGAACGGTCAACCCGCGATGGCTGGTGCGGACGGTCGTGCCGGCTGCACGAGAGCTGCGGGAGAC
CCACGGTGCCTCAATGGTCTATCTCCGACGCGGCTGGCTACACGGCCCGCATGTCGACCTCGTGGCGCGC
GTGGACCAGGGCGGCAGCCCCCCGCCGTGGGACGAAATGGCCCACCGTCTCGATGCCGGCCCGCTCGACC
CGTCAAGCGCGATCAGCGAGGAAACCTACCTGGAAAAGGCACGTGAGTTCGGCCGCCTGGAGCGGGTCCC
CCCTCCCTACCTGCCGATGCGAGCGCACGGCACGGTCGAACGGCTCGGCCCAAGCGACACCGCGCGCTGG
CCCGTGGCCCTCAACGCGCTCCGCGAGGTCGCCCTCGGCCGCCTGGACCTCCCCCTGATCGACACACTGG
AGGACGTCGCCGAGCATGGGGCGCAGGCCGAAACCCGCGTACTGGAAGCCTTCGTGGCCCTCGCCGATGC
GCACCACGCCGGCGTCGCCTACGGTGTGTTCTCGCTGCGCTCGCACGTGGAGGCTTTCCTGAGCTGGGCA
TCGGCCCGCAAGGATCCGCGTCCCGCCTTCCGGGCCAGGCTGGCGTCGGACGCGCCGCGGCTGCGCTCGC
TGGTCGAGTCCGCCCTCAAAGGCGACATGAATCGCCACTACACCGCCTGGCAGACGGCGTTCGCCTACAC
GATGGGCGTCTTCGATCACGCCGTGCTCACCGGAGCACTGACCCTGGACGGGCTTGACGAACTCGACGGC
GGCTTCGACCCCGCCACCATGGGCCCACCGGGACGGCCGTCGATGGCTGATACCGGGCCCAGCGACTTCC
ACCGGGTCATGAACGACTCAGGTGTGATCGCCGAGCCGCCGCAGTGGTTCGCCTCGTACCGCCTGCTCGT
GAATCTCTTCTACCAGCAGCTGCCCCTGCTGAGCGTCTCCCCGCTGCACCGCTACTACGTCTGCTACGCC
GTCGCCGAGACGGTCGACGAGGTGCTGGGGGAGTCCTGGCAGGAGCGGTTGGAGCGGAGGGCCAGCCGGG
CATGA
 Primer design

Protein Sequence:374 a.a.
>Francci3_4195|ThioFinder525 Frankia sp. CcI3
MTVKTAEPKVPPSDDTVTGLRLFTRGTVNPRWLVRTVVPAARELRETHGASMVYLRRGWLHGPHVDLVAR
VDQGGSPPPWDEMAHRLDAGPLDPSSAISEETYLEKAREFGRLERVPPPYLPMRAHGTVERLGPSDTARW
PVALNALREVALGRLDLPLIDTLEDVAEHGAQAETRVLEAFVALADAHHAGVAYGVFSLRSHVEAFLSWA
SARKDPRPAFRARLASDAPRLRSLVESALKGDMNRHYTAWQTAFAYTMGVFDHAVLTGALTLDGLDELDG
GFDPATMGPPGRPSMADTGPSDFHRVMNDSGVIAEPPQWFASYRLLVNLFYQQLPLLSVSPLHRYYVCYA
VAETVDEVLGESWQERLERRASRA