Home 

Gene Symbol:  
MCAG_03945
Organism:  
Micromonospora sp. ATCC 39149
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4698841..4699863 [-1], 1023 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_04607688.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1023 bp
>MCAG_03945|ThioFinder746 Micromonospora sp. ATCC 39149
ATGACTGACGACGCCACGCGCTGGCTGTCCTGCCACGTGTTCTACCACGACGATCCCGACCCGCTGCTCG
CCGGCCTGCTGCTGCCGATGATCGACGGGCTGCGCGCACGCGGGCTTGCCCGGCAGGCGTTCTTCCTGCG
GCACTGGGAACGTGGCCCGCACGTACGGGTGCGGCTGCGCGTCGCCGAGGCGGATGCGGACGCGGTCCGC
GCCGACGTCGAACGCACGGTCACCGCCTACCTGCGGGAACATCCCGGGCCCGCGGGGCTGGAGCCGGAGA
GGGTGCGCGACTCGCTGCGACACCTGAGCCGCCTGGAGCACGGCACCGACGAGATCGGGCAGGTGACCGA
GCCGGAGCCACCGAACTCGCTGCGGTGGATCGACTACGAACCGGAGTTGGCCAAATACGGCGGCCCGCGC
GGCGTCGCCATCGCGGAGCAGGTGTTCGACGGCAGCTCCCGGCTGACCGCCGAGGTGATCCGCACCGTTC
CCGTCGACCGCGCACGGCTGGGCATCTCCCTGCAACTGCTCCTGCTCTCCGCCCGCGCGCTCGGCCTCGA
CGCGGCGGCACGCACCGTGTTCCTGCGTCACTACCGCGAACGCTGGGCGCCGTACGTGCCCGACCCCGAC
CGCCTCTTCGCCGCCTGGGACGGACAGTACCGGCACCAGGCGGACACCTACCGGAGACTGCTGCGGTCGG
TCGACCGTGGCGATCCGGTCGGCGGCGGGCTCGGCCAGGCGTGGGAGCGCCTGCTCGGTGACGCCCTCGC
CGCCCTCCGGCCGTTGGTGGCGGCCCGACAGGTGTGGCCCGGCGAGGTGGCGCCGGAGGCCCCTCCGTTC
GTCGCGCTCGCCGCGCTCGTCTGCCAGTACCTGCACACCACCAACAACCGGATGAACGTACGGCCCCAGG
GCGAGTGCTTCGTCGCGTACCTGGGCCACCGCGCCGCACTGGATCTGGCCGGCACCGCCATGCCGGACAC
GGCGGACGCCACCATGTCGACAAGCAGGAGTAGCCATGTCTAA
 Primer design

Protein Sequence:340 a.a.
>MCAG_03945|ThioFinder746 Micromonospora sp. ATCC 39149
MTDDATRWLSCHVFYHDDPDPLLAGLLLPMIDGLRARGLARQAFFLRHWERGPHVRVRLRVAEADADAVR
ADVERTVTAYLREHPGPAGLEPERVRDSLRHLSRLEHGTDEIGQVTEPEPPNSLRWIDYEPELAKYGGPR
GVAIAEQVFDGSSRLTAEVIRTVPVDRARLGISLQLLLLSARALGLDAAARTVFLRHYRERWAPYVPDPD
RLFAAWDGQYRHQADTYRRLLRSVDRGDPVGGGLGQAWERLLGDALAALRPLVAARQVWPGEVAPEAPPF
VALAALVCQYLHTTNNRMNVRPQGECFVAYLGHRAALDLAGTAMPDTADATMSTSRSSHV