Home 

Gene Symbol:  
MCAG_03946
Organism:  
Micromonospora sp. ATCC 39149
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4699856..4702483 [-1], 2628 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_04607689.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2628 bp
>MCAG_03946|ThioFinder747 Micromonospora sp. ATCC 39149
TCAGTCATCGTCGCCTCCCACGGTCTCCAGCAGGTACTCGCGCACCCGCGCGTCCGGCCCGCCCCGGCCG
ACCTCGGCGCCCGGCAGCGGAAGGCACTCCTGCAGCGTCAGGTCGTCGTCGACGCGGCTCAGCGTGCGCT
GCCAGGCCCGCACGCTCGTCACGCTGGTGAAGTCCACGAGCGCGGGCTTGCGGGCCGCGGAGGACGGGAA
CTGCACGAGCGAGCGCGCGTTGCGCCGGCGCTGTTCCGCCTCGAGCGGGACGAGCGGATCCGACAGCGTG
AACTGACGGGAGAAGACCAGGTCCGGCAGGCCAAGGTCGTGCTGCCAGCGGCGGATCTCCCGGTAGCCGG
CGAGGCCGTCCTGCCCGGCGACGGCGGGCAGGCTCGCGGGCGGCAGCTTCCAGGTCCGTCGGGCCACCAC
GACGCTGCCGACACGCACCCGGGGGTACGCCCGCACGCCACGGTCCGCTCCGGTCGACGGCTGCCGCTGG
TCGACGCGATCCCACCAGCCGAGGTTGGCCAGCGATCCGGTCGAGAAGAAGGAGAGGAAGCGGTAGAACT
GCGGGGCGAGCTCGTTGAGCAGGAAGTTGAGTGGGACCAGCCGCAGCGGCGGGCCGTCCCGGCCCACGGT
GAGTTCCAGCCGTCCCCCGTGGACCCGCGCCCAGCAGTCCTCCAACGAGATGCCCGCGCCCGGCCAGCCG
CCCGGGGTGCCGCAGGGGTAGCGCAGGTAGCGCGGCAGCAGGGCCGGGTGGATGTTCGCGTTGATGCCGA
GCACGGCGGACAGGTCGACGGACCGGATCGGCGCGGTGTCGGGCTCGGCCAACTCGCGGCGTACCGTCTC
GGTGAAGCGTGCCGCCGCCGCGTCGGCCGCCTCGAAGGAGTAACAGAACCGGGAGATGGTGCGGCCGTAG
CCGATCGCCGAGGAGTTCAGCACCAGGCGCTCCGCGCCGTCCTCGCCGGCGTAGCGCTGCACCTGCCAGC
TCACCCGCGCCCAGCGCGACACCCAGTCGGGCTGGTCGGCCAGTGCCCGTAGGCGCGCCGGGTCGAGGAC
GACCTCGGCGTCGCCCGGCGTGCCGGGGTCGACCATGCCGAGGACCTGGTCCTGGAGCTGGCGCAGGGCC
ACCGGGATCGGCGCGTGCAGGTCGACCAGGCGGGCGATCAGCGCGTTGCGCGCCCTGGGCACGGACAGGG
CCGAGTAGAGCGTGAGCAGGCGGTGCGGCCCGGGGCCGAACATCGCCTCGACGACCTGCGCCACGGTGGC
CCGGGTGTGGGCGTGGTCGTCGAACCACGGTACGACCCGGTGCAGCGCGGCGAGGGTGTCGAGGTGCGAC
TCCCACCGAGCTCGGGGCTCGGCCAACGGCCGGGGGTCGACCGCGTCCTCGTACATCAGGGTGCGGGCGA
ACTCCAGGGGCGGCAGGTCCACCCCGCACAGCCCGGCCAGCGCCGCGATCCGGGCGCGCAGCTCGGCCAG
CAGGTCGCCGCGCTGCCGCGGGTCCGCCCCGGCGAAGGCGGTCTCCGCGTCGAGCAGGGCGCGGACCGCG
TCGCGCAGCTGTTCGGGGCAGTCCCCGGGGAGCAGACGGAGCAGGGCGCGCAGCGGGTCGCCGTCCTGTT
CGCCGAGGCCGAGGTCGGCGGCGAGGACGCCGGCCTGCTGGAGGCCGACGACGTCCGCCTCGCCGCCGCC
AGTCGAGGCGCACCGGCGAATCAGCTCGGCCCGGGTCACCGGGTCGTCCGCGGGCAGCCGGAGCACCTCG
GCGAGGGTTTCGGTGCGGGGCAGGCGGACGATGCGCTCGGTGAGCGCGGACTCGGCGGTGCCGTCGCGGC
CACGGACGAGGAACGACACGGTGTCGGCGGACGCGGACACGACTGGTGCCCGCCGGAGCGTGGCGTGCTC
GCGGAGCGCGGGATGGTCGGCGAGCGTACGTTCCACCCAGTTGACCAGCTGGCGGGGCAGGCGGCACACG
GAGCGGACCTGGTCCGGCTCCGGCTCCGGCGCAACGTCCGACTGGAGCAGTACCGGCCGGGTGTGGGTGA
GCTGACCGAAGGGCGACGGCTTGAGGATGCTGCGGGTGACGAGGTTGACGAGGGTCGCCTCGGTGGTCCG
GGCCCGCTTGTCGCGCCCGGCACCGGTCGCGACGTCGTCGGCGAACCGGTCGATGTTGTGCAGCAGGCTG
TCGGCCGTGAGCTGGGCGCCGGCGCGCAGGGGTGCCTGCCGGGCCAGGTCGGCCAGCGCCTGCTGCTCGG
TCGACCAGCTGGTGTCGTACTCGGTCGGCAACAGCGCGGACAGCGACTCCCGCCGGGCGGCGAGGGCGGC
CAGCGCCGGTGCGCCGGGCACGGCGTGCTCGACGAGCACCGCGAGGTCGTCGGCCTCGACGGGTGCGCCG
CGGTGCAGGCGTCGGCGGGTGCGCAGCACCTCCGCCCGGAGTTTCCGGTCGGGCAGCTCCGGCACCAGCG
AGGTGGCCGCCTCGGCCACCCGGGGCGCGTGACGCGACCAGTCCCGGTCCAGTACGGCCAGTTCGGTCAG
CAGGTCCGCGAGTTTCGGTGAGCGGAGATCTTCCAGGGCGGACGCCGGCAGGGCGGACACCCGGACGACG
CCGTATCCGGCGAGCCTGGTCTCGGATGAAGGCGACAC
 Primer design

Protein Sequence:875 a.a.
>MCAG_03946|ThioFinder747 Micromonospora sp. ATCC 39149
MSPSSETRLAGYGVVRVSALPASALEDLRSPKLADLLTELAVLDRDWSRHAPRVAEAATSLVPELPDRKL
RAEVLRTRRRLHRGAPVEADDLAVLVEHAVPGAPALAALAARRESLSALLPTEYDTSWSTEQQALADLAR
QAPLRAGAQLTADSLLHNIDRFADDVATGAGRDKRARTTEATLVNLVTRSILKPSPFGQLTHTRPVLLQS
DVAPEPEPDQVRSVCRLPRQLVNWVERTLADHPALREHATLRRAPVVSASADTVSFLVRGRDGTAESALT
ERIVRLPRTETLAEVLRLPADDPVTRAELIRRCASTGGGEADVVGLQQAGVLAADLGLGEQDGDPLRALL
RLLPGDCPEQLRDAVRALLDAETAFAGADPRQRGDLLAELRARIAALAGLCGVDLPPLEFARTLMYEDAV
DPRPLAEPRARWESHLDTLAALHRVVPWFDDHAHTRATVAQVVEAMFGPGPHRLLTLYSALSVPRARNAL
IARLVDLHAPIPVALRQLQDQVLGMVDPGTPGDAEVVLDPARLRALADQPDWVSRWARVSWQVQRYAGED
GAERLVLNSSAIGYGRTISRFCYSFEAADAAAARFTETVRRELAEPDTAPIRSVDLSAVLGINANIHPAL
LPRYLRYPCGTPGGWPGAGISLEDCWARVHGGRLELTVGRDGPPLRLVPLNFLLNELAPQFYRFLSFFST
GSLANLGWWDRVDQRQPSTGADRGVRAYPRVRVGSVVVARRTWKLPPASLPAVAGQDGLAGYREIRRWQH
DLGLPDLVFSRQFTLSDPLVPLEAEQRRRNARSLVQFPSSAARKPALVDFTSVTSVRAWQRTLSRVDDDL
TLQECLPLPGAEVGRGGPDARVREYLLETVGGDDD