Home 

Gene Symbol:  
MCAG_03943
Organism:  
Micromonospora sp. ATCC 39149
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4696109..4697158 [-1], 1050 bp
Product Function:  
nitroreductase
Product Locus:  
 ZP_04607686.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1050 bp
>MCAG_03943|ThioFinder744 Micromonospora sp. ATCC 39149
CTGGACTCCGGCGCCGTCATCGGCCAGTTCGAGTCGGTCGCCCGGCGGTGGGGCTGGTCCTGCCGGGTGA
CGTTCAGCACCGACGAGCGGGACGTTCTGGCCCACCTCGGCCTCGACCCGACGGACGAGGCGGTCGTCGC
GGTGATCGACGTCGACCCCCACCAGCCGGTGCCCGCGATGCCCGCACCGGTCGCGCTCTCCGCCCCCACC
CCCCGGCCCGCCCGGTGGACCGGCGCCGCCAAGCGTCCGCCCCGGACCACCGGCGCGGCCCGCATGCACG
CGGCATGCCAGGAGCGGGGCGGGCGTACCGGCCCGGTGCACCTGCCGCCACTCGCGCTGCCCGACGCCCT
CACCGGCGGCGCGGTCCACCCGCTGCCGGCGCAGGGGACGCAGGCGGTGCCGGTCGCCGCCTCCTGGGCA
CGCACGGCCCTGGCCGAGCAGCTACGGCCCACGCCGCTGGCCGGCGCGGACCTGGCGCGGTGGCTCGACC
AAGCCTGCGCGCCGCTGGACAGCGACCTGCCCGGCGGCGGAGCCGCGCTCGACCAGGTGCGGTGCGTGCT
GCTCGCCCGCAACGTGACCGGCCTGCCGGCCGGCGCCCACCTGGTCGACCACGAACGGCGGTCGCTGCGA
ACGCTGGCCGACGGCGACTTCGGCGCGCGCGTGCTGCACAGCATGTTCGGCCGGTACATGAACCTGGCCC
AGGCACCCGCGATCGTCCTGCTCGTCGGCGCGGCCTCGCCCCACCGGGAGGCGGGCGACCCGCTGGCCTA
CCGGGTGCAGCACCACGTCGCCGGGCTCATGGCGCTGCGGATGGTTTCGGCCGCCGCCGCGTCCGGCGCC
ACCGGGCACCCGGTGCTGGGCTTCGCCAGCGGCGAACTGGACGAGCCGCTCGGCCTGCGCGACGCGGGCT
GGACGGCGCTGCTCATGGTGGCCTTCGGCGCGTACCGGCGCGGCCTGTACCTGGAGTCGAGCATCAACCC
GGTCGCGGCCCGCGCGGCGGGCCGCATCACGCAGGACGAGGCATCCGCACCCCTGGAGGCGATCCGTTGA
 Primer design

Protein Sequence:349 a.a.
>MCAG_03943|ThioFinder744 Micromonospora sp. ATCC 39149
MDSGAVIGQFESVARRWGWSCRVTFSTDERDVLAHLGLDPTDEAVVAVIDVDPHQPVPAMPAPVALSAPT
PRPARWTGAAKRPPRTTGAARMHAACQERGGRTGPVHLPPLALPDALTGGAVHPLPAQGTQAVPVAASWA
RTALAEQLRPTPLAGADLARWLDQACAPLDSDLPGGGAALDQVRCVLLARNVTGLPAGAHLVDHERRSLR
TLADGDFGARVLHSMFGRYMNLAQAPAIVLLVGAASPHREAGDPLAYRVQHHVAGLMALRMVSAAAASGA
TGHPVLGFASGELDEPLGLRDAGWTALLMVAFGAYRRGLYLESSINPVAARAAGRITQDEASAPLEAIR