Home 

Gene Symbol:  
MCAG_03942
Organism:  
Micromonospora sp. ATCC 39149
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4692406..4694187 [-1], 1782 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_04607685.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1782 bp
>MCAG_03942|ThioFinder743 Micromonospora sp. ATCC 39149
GTGGTGGACCCGGGTCGGGACGCCGACCTGACCGCGCCGGCCTTCCACACCGCGCCGGTCCTACCCGTGT
ACGGCCTGCGGGGACGGCTGGTCGTCGGCCCGCTCGTCGAGGCCGGCGACGCCGGCTGCCCGAACTGCCT
CGCGTTGCGGGTACGCGCCCTGAACCGACCCGAAGCCGGCACGGACGATCCGGCGCCGGTCGCCGTGCCG
TTGTCCGGGCGGGACGTGCCCTGGCCGGCGGCGGCGATCCGGATGGCGGCGGCGGTGGTGGCCGACGAGG
TACGCCGGCTCGAAGCCGGAACCGGCCCGCGCACCCGGGGCGCGGCGTTCGTGGTCGACGTCGCCCGGAT
CTCGGCCGACTGGCACGAGGTGGTGCCGCACCACGCCTGCGCGTCCGCCACCTGCCGCAGCGCCCGACGG
CCGGTCCCGCCGCCCCACCCCGACCTGGCGCGCCGGCTGCCCGCCCGGTCCGCGACGAGCGGCCGGCGGT
TCTCCCTGGACCACTACCGTCAGGTGCGGGACAGCGGCTACCTGGATGCCTGGTCGGGTGTGATCACGGC
CCCCGCGATATCGAGCAATGCCGCGCTGCCGGCGGTGCAGGCGAAGGTCCCGACCCGGTGGGGGTTCCAG
GAGATCTGCATCGGGCACGCCGACACGGTCGCCGATGCCCGTACCGCGGCCGTGCTGGAAGGGCTGGAGC
GGTACGCCGGGTGGCACAGCGGCGGCCGGCGGCCGGTTCGGGTGGCCGCGTTCGCCGAACTCGACGACGC
AGTCGACCCGCGGCAGTTGCTGCTGCACGAACCGGACGCCTACCGGCAGCCCGGGTTCCCGTACGTCCCG
TTCCAGCCCGACCTGCCGGTGGCCTGGGCCGAGGCGTTCGACGTGACCGGCAACCGGACCGCCCTGCTGC
CGTTCCACGTGGCGTACTACGGCGCGACCCGGGAACCGAAGCTCGGCCCGTCCTTCGTGTACGAGAACTC
CAACGGCTGCGCGCTCGGCGCGGGCCCGGAGGAGGCGTTGCTGGCGGCGCTGCTGGAGGTGGTGGAGCGC
GACGCCTTCCTGCGCGCCTGGTACTCCCGAACGCCCCTGCCCGAGCTCGACCTGACCGGGCTCACCGGCG
ACGCGGCCCTCACCGTGCGGACGCTCGCCCACCGCACCGGACGGACGCTGCGCGCCTTCCGCGCGGTGGG
CGAGCTCGGACTGCCGGTCGTGCTGCTCGTCTCGCTGTCGGACGATGCCGGGCAGCCCGCCACGCTGATC
ACCGCCGGGTGCGCGCTGGACACCACGGGCGCGCTGCTCGGCGCCGCGCACGAGATGGCGCTCGTCGCGC
CGGTGGCCGCCCTGAACTTCGGGCGTCGGCGGGCGGAACTCGACGCCATGCTTGCCGAACCGGAGCGGGT
CAGGGCGATGGCGGACCACGCGCTCGTAGCGGCCCTGCCCGCCGCGCGGGACCGGTTCGCCTTCCTGCTG
GACCCGCCGGTCGCCGCGACGCCCGTCGCGCCGACGCACCGGCCGCGCGGCGACGTCGCCGCCGACCTGG
CCGCGCTGCTGGCCGCCGCCAGGGAGACCGGGTTGCGGGTCCTCGTCGTCGACCACACCACGCCGGAGCT
GCACCGACTCGACCTGACGTGTGTCAAGGCCGTGCTGCCCGGGACGGTGCCCATGACCTTCGGGCACCTG
CACCGCCGGATGCCTGGCGACGCCAGCCTGGAGAGCTTCCGGCGCCGACACCACGCGACACCGCTGACCG
AGGTGAGACATGATCCGCACCCCTTCCCCTGA
 Primer design

Protein Sequence:593 a.a.
>MCAG_03942|ThioFinder743 Micromonospora sp. ATCC 39149
MVDPGRDADLTAPAFHTAPVLPVYGLRGRLVVGPLVEAGDAGCPNCLALRVRALNRPEAGTDDPAPVAVP
LSGRDVPWPAAAIRMAAAVVADEVRRLEAGTGPRTRGAAFVVDVARISADWHEVVPHHACASATCRSARR
PVPPPHPDLARRLPARSATSGRRFSLDHYRQVRDSGYLDAWSGVITAPAISSNAALPAVQAKVPTRWGFQ
EICIGHADTVADARTAAVLEGLERYAGWHSGGRRPVRVAAFAELDDAVDPRQLLLHEPDAYRQPGFPYVP
FQPDLPVAWAEAFDVTGNRTALLPFHVAYYGATREPKLGPSFVYENSNGCALGAGPEEALLAALLEVVER
DAFLRAWYSRTPLPELDLTGLTGDAALTVRTLAHRTGRTLRAFRAVGELGLPVVLLVSLSDDAGQPATLI
TAGCALDTTGALLGAAHEMALVAPVAALNFGRRRAELDAMLAEPERVRAMADHALVAALPAARDRFAFLL
DPPVAATPVAPTHRPRGDVAADLAALLAAARETGLRVLVVDHTTPELHRLDLTCVKAVLPGTVPMTFGHL
HRRMPGDASLESFRRRHHATPLTEVRHDPHPFP