Home 

Gene Symbol:  
MCAG_03944
Organism:  
Micromonospora sp. ATCC 39149
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4697745..4698848 [-1], 1104 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_04607687.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1104 bp
>MCAG_03944|ThioFinder745 Micromonospora sp. ATCC 39149
ATGTCTAACAACAGCTTCCAGCTCACGGTCAACGTTCCCTGGTCGGTGCAGGAGGACATCCTGCTGGACG
TGGCCGCGCCGCTGCTGGACCACTCGATGGAGCTCGGCGAGACCGAGCGGTGGTTCTACCTGCGCGAGAA
CCACCGGGGCACCCCGTACCTGCGGTTGCGCATCTGGTGCTCCACCCGTTCGGTGGTGGAGCGGCTCAAG
GCCCACATCGCCACCCAGGCCGTCGGCGCGGCGGCCCCCAACGAGATGTTCGTCGACCGGCCGTACAACT
ACGAGCACGACTGGCTGGGCGGGCCGGGCGGCCTGGACATGCTGGAGTCCTTCTGGGCGGAGACGACGCC
GCTGGCGGTCCGGTCGTTGCGCCTCACCCGGGGCGACCGAGCGCTGCGGATGGCGCACGCGTTCGACCTC
CTGGTCTGCACCGGCGCGCTGCTCGGGCCGCGCCTGCCGGGGCGGCTCGGTGAACTCGGCTTCCGCGCCG
GGTACCTCTCCTACCTCGCCACCTACGAGGGATACCTGCTGCTCATCCGCGACCCGGAGGCGGTGCGGGC
CAAGCAGAACCGGCGCTACGAGATGAACCGCGACCGCCTGCGGGCCCGGGCCCGGGAACTGGTGGAGGCC
CTGCAGGAGCCGGAGGGAGACCTGTCCGGCCTGCCGGAGTTCGCCGGGGAGTGGACCCACGTCCTGCGCT
CGTACCTGCCGCGCATCCAGCAGGGTTTCGACGAGGGCCGGCTGTTCCTGTACGCCAACCCGCGCAACGG
AGAGTTGGTCAAGCTCGCCCCGTCGCCGGACGGCCTCTACCGCCGGCCGGAGGTGCCCTGGCTGGCCGAC
GCGCCGACGCCGGCGGTCGCCGGCATCCACCGCGCGATCGCCGACAACCCCTACTTCCAGGGCATGATCC
GCGAGGACCGACGGTTTTTGGCCTCGCGGCTGGCCCAGGGATACACCCATTGGCACCTCTACCGCCTCGG
GTTCACCCTGGCCGACCGGTACACCCTGTTCCACCTCGTCGCCCGCAGCTTCGAGGAGGAGTTCGGCCTC
GACGCGGTGGAGATCATCCGGTCGGTGCAGCCGGAGTCCGAGGCGGCGCGATGA
 Primer design

Protein Sequence:367 a.a.
>MCAG_03944|ThioFinder745 Micromonospora sp. ATCC 39149
MSNNSFQLTVNVPWSVQEDILLDVAAPLLDHSMELGETERWFYLRENHRGTPYLRLRIWCSTRSVVERLK
AHIATQAVGAAAPNEMFVDRPYNYEHDWLGGPGGLDMLESFWAETTPLAVRSLRLTRGDRALRMAHAFDL
LVCTGALLGPRLPGRLGELGFRAGYLSYLATYEGYLLLIRDPEAVRAKQNRRYEMNRDRLRARARELVEA
LQEPEGDLSGLPEFAGEWTHVLRSYLPRIQQGFDEGRLFLYANPRNGELVKLAPSPDGLYRRPEVPWLAD
APTPAVAGIHRAIADNPYFQGMIREDRRFLASRLAQGYTHWHLYRLGFTLADRYTLFHLVARSFEEEFGL
DAVEIIRSVQPESEAAR