Home 

Gene Symbol:  
SSNG_06376
Organism:  
Streptomyces sp. C
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
7102241..7103296 [-1], 1056 bp
Product Function:  
conserved hypothetical protein
Product Locus:  
 ZP_07290755.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1056 bp
>SSNG_06376|ThioFinder765 Streptomyces sp. C
ATGTCCGAACTGACCCCGACGCGTGGCGCGTGGCAGGCCGTGCACGTGTTCTACGCCGCCAACCCGCAGC
CGCTGCTGGTGCAGTGCGTGCGTCCGCTGATCGCCTCCCTGACGGCGGACGGGCTGCTGGCCGGGCACTT
CTTCATCAACTACTGGCTGGAGGGCCCGCACGTGCGGCTGCGGCTGCGGCCGGTGAGCCCGGAGGCGGAG
CCGGAGGTGCGCCGCCGGACCGAGGAGGCGGTGTCGGCGTTCCTGAAGGCGCGGCCGGCGCTGTACGAGG
TGGACTCGGGCTTCCTCAACGAGTTCTACAACACCCTGTTCGACATCGAGTTCCCGGACGGGGACCGGGC
CGCGTTCATGGGCGAGGACGGCCGGATGAACCTGCGGCCCAACAACTCCTTCTCCTACGAGCCGTACGAG
CCGGAGTACGGCAAGTACGGCGGGCCGGCCGGGGTGGAGCTCGCGGAGTGGCACTTCGCGCACTCCAGCG
ACCTGGTCATGGAGGCCCTGGGGTCGATGAACCTGCACCTGCGGACGGTGCTGCTGGGCACCTCGGCGCA
GCTGATGATGGTGATGGCCGGGGTGTTCCTGCCCGACCGGGAGGAGCTCGGGAACTACCTGGACGACTAC
TACCGGTTCTGGCACCGGGCGTTCCCGGGCACCGGTTTCATCGGCTCGACCGAGTACGACCGCACCTACG
AGCAGACCGGCCCGGGTCTCGGGCGGCGGTTCGAGGCCGTGCTGGAGGCGCTGGCCTCCGGCGAGACGGG
CCGGCTGCCGGGCTTCCTGGCCGGCTGGGCCGAGCACTGCCGTGAACTGCGGCGGCGCGCGGAGGCGCTG
GCGGTGGCCGGGGATCTGGTGTTCCGGTCCTGGGACGGGAGCCGCGACGAGCGGGTGACCGATCCGGCGG
CGGCGCTGCCGCTCCTGCTGTCCCCGTACATGCACATGACCAACAACCGGCTGCACGTGACGATCCGGGA
CGAGGCCTACCTCTCCCACCTGCTGGGCCGGGTGCTGCGCGAGGGCGCGGGGACCGGCGGGGTGGTCGTG
CCGTGA
 Primer design

Protein Sequence:351 a.a.
>SSNG_06376|ThioFinder765 Streptomyces sp. C
MSELTPTRGAWQAVHVFYAANPQPLLVQCVRPLIASLTADGLLAGHFFINYWLEGPHVRLRLRPVSPEAE
PEVRRRTEEAVSAFLKARPALYEVDSGFLNEFYNTLFDIEFPDGDRAAFMGEDGRMNLRPNNSFSYEPYE
PEYGKYGGPAGVELAEWHFAHSSDLVMEALGSMNLHLRTVLLGTSAQLMMVMAGVFLPDREELGNYLDDY
YRFWHRAFPGTGFIGSTEYDRTYEQTGPGLGRRFEAVLEALASGETGRLPGFLAGWAEHCRELRRRAEAL
AVAGDLVFRSWDGSRDERVTDPAAALPLLLSPYMHMTNNRLHVTIRDEAYLSHLLGRVLREGAGTGGVVV
P