Home 

Gene Symbol:  
SSNG_06377
Organism:  
Streptomyces sp. C
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
7103861..7104703 [-1], 843 bp
Product Function:  
lantibiotic dehydratase domain-containing protein
Product Locus:  
 ZP_07290756.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:843 bp
>SSNG_06377|ThioFinder766 Streptomyces sp. C
CGCAGCACCACGCGGCCCGGTCTGCGGAACGTGCTCCGCGTACAGGTCGTCCAGGCGCAGCAGCCGCTCC
TCGGGCAGGGTCCCGCTCTCGCCCGGGCAGACGATCTCGTACTCGGTGAGCCGCCCGTGCAGGTTCAGGT
TGGTGGTGACCGCCCCGCCCGTCACCTCGGCGAACACCGCCCCCGGCGGGGTGACCCCGGCGGCCGTCGC
GCGCAGCTCGCCCTCCAGCCCGGCCGGTTCCGGGTAGAGGTGCGTGAACCGGCTGAACGGGAAGGAGAGC
CCGCCGTACGAGCGGTTGAGCACGGTCAGGTCCGCGCCCGTCTCCGGGTCCCGCGCGAGCTGGAGGTGGT
GGCAGCGCGGCGCGAAGCCGGGCACCACCGGCTCCAGTTCGGCCGCGACCGCCTCCACGTCCTCCCCGGA
CAGCCGCAGCTCGCCGCCGCCCGCGCCGTGCTCCTCGTACGCCGCCCAGTGCGCCCGCATCCGGTCGGTG
AAGGCCCGCCGCGCCGCGTCCAGGGCCCGGATCCCGGGCAGGCCCAGCCAGTTCTCCTCCGGCACGTACT
CGCCGCGCGCGTCGAAGGGGGTGCGGCGCGCGGTGAAGGACAGGTACTGGTCGAAGAAGTCCTCGTGGAA
GTCGTGCACCAGCCCCAGCAGGTCCTCGCAGCGCCCGCCCGGGCCGTAGCGGGCCGTGAAGAACCCCTCG
AAGGTGATCCGCTGGGCCGCCGTCAGGTCGAAGGCCGGCAGGATCCGCTCGACCGAGCGCAGCGACCCGC
CGCCCGAGCCCGGCTCCGCCCAGGCCGGGGGAGCCGCCGCCAGGTCGCGGCCCGCGCTGGTGTCCTCGTA
CAC
 Primer design

Protein Sequence:280 a.a.
>SSNG_06377|ThioFinder766 Streptomyces sp. C
MYEDTSAGRDLAAAPPAWAEPGSGGGSLRSVERILPAFDLTAAQRITFEGFFTARYGPGGRCEDLLGLVH
DFHEDFFDQYLSFTARRTPFDARGEYVPEENWLGLPGIRALDAARRAFTDRMRAHWAAYEEHGAGGGELR
LSGEDVEAVAAELEPVVPGFAPRCHHLQLARDPETGADLTVLNRSYGGLSFPFSRFTHLYPEPAGLEGEL
RATAAGVTPPGAVFAEVTGGAVTTNLNLHGRLTEYEIVCPGESGTLPEERLLRLDDLYAEHVPQTGPRGA
A