Home 

Gene Symbol:  
SSNG_06378
Organism:  
Streptomyces sp. C
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
7106184..7107734 [-1], 1551 bp
Product Function:  
conserved hypothetical protein
Product Locus:  
 ZP_07290757.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1551 bp
>SSNG_06378|ThioFinder767 Streptomyces sp. C
GTGGGCTACGCCCATGACTACGCCAGCGCCATCCTGTACCGGGGCCGGGTGCCCATGGAGCCCGTCGACT
TCGTGCCCGACTGGGCCGACCGCCCCCGCAAGGCGAAGTACTACCCCGGCGCGGAGACCCTGCCGCTGCC
GGAGCCGGAGTCCGGCGGGCCGCGTCCCGCGCCGGGGTTCACCCTGCCGCTGCTGTCCGGGATGCTCCAG
GAGTCGTACGGGCTGACCGGACGGCGCCTGGGCGTGCAGGCCAACACCGACCTGGCGGCGCTCCCCCACT
ACACGCAGGCCAACTGGTCGCGGGGCACCGCCTCGGGCGGCGGGCTCTACCCGGTCGGCGTGTACTGGGC
GGCCGGCGCGGGCGGGCCGCTCACCCCGGGCCTGTACCACTACGCCCCGCACCAGCACGGGCTGCGCCGG
CTGCTGGCCGGCGACGTCACCGGTGACGTGCGCCGGGCGCTGGGGCCCGGCCCGGGCGAGGGCGCGTCGC
AGTACCTGGTGCTGAGCGTCAAGTACTGGCAGAACTCCTTCAAGTACAACAGCTTCTCCTTCCACGCGGT
GAGCATGGACGTGGGCGCGCTGGTGCAGACCTGGCGGCTGTGGGCCCGGGCGTACGGGCTGCGGATCGCG
CCCGTGCTCTGGTTCGACGAGGAGCGCCTCGCCGGGCTGCTGGGCGTGGCCCCCGAGGAGGAGGGCGTCT
TCGCGGTGCTCCCCCTGGAGTGGGAGGGCGACGCGGCCGGCCCCGCCGCCGGGGCTCCGCCGACGGGCGC
CGGGGTGCGGCACCGGGACGCGGAGCGGTCCCGCACCGTGCTGGCCTTCGAGACGCTGGAGCGGATCCAC
GGAGCCACCCTCGGCCGGGCCGGGGACCGTCCGGCGCCCGGCGCCCTCGACGCGGCCGCCGCGTACCCGC
CGCGGGGCGGGGAGCCCGTCCCGCTGCCCGCCCCGCCGGCGCCCCCGATGGGGGAGACGGCCGCGCTGCG
GGCCCGGCGCAGCAGCTTCGGCCGGTTCGACGCCGGCCGGGCGGTGACGGCGGAGCAGCTGGCGGCGGCG
CTGGCGCAGTGCGCGGCGACCCGGCCCGGCAGTGAGGCGGAGCGGTCCGACGGGCCGCCGCTGACCTCCC
TGTACGTCTTCGTGAACCACGTCGAGGGGATCGAGCCGGGCAGCTACGCCTACGACCCGGCGGAGCACGC
GCTGCGGCTGGTGGTGCCGGGTCCGCCCGGGCCGTTCCTCCAGGCCAACTACTTCCTGTCCAACTACAAC
CTGGAGCAGGCGGGCGCCGTGCTGGTGCCGACGGTGCGGACCAGCGCGGTCCTCGACGCGGTCGGCGACC
GGGGCTACCGCCTGATGGGGGCGGCCGTCGGCGCGGTCGCGCAGACCTTCTACACCACCGCCGCCGCGCA
CGGGCTCGGCGCGGGCGTGGCGCTGGGCTTCGACAACGTCTCGTACGCCGAGCGGCTGGGGCTGGCGGAC
ACCGACGAGGCACCGCTGCTGATCATGCTGCTCGGCCACGAGCGGCCGCGGCCCGCCGACTTCCGCCACG
AAATCGCCTGA
 Primer design

Protein Sequence:516 a.a.
>SSNG_06378|ThioFinder767 Streptomyces sp. C
MGYAHDYASAILYRGRVPMEPVDFVPDWADRPRKAKYYPGAETLPLPEPESGGPRPAPGFTLPLLSGMLQ
ESYGLTGRRLGVQANTDLAALPHYTQANWSRGTASGGGLYPVGVYWAAGAGGPLTPGLYHYAPHQHGLRR
LLAGDVTGDVRRALGPGPGEGASQYLVLSVKYWQNSFKYNSFSFHAVSMDVGALVQTWRLWARAYGLRIA
PVLWFDEERLAGLLGVAPEEEGVFAVLPLEWEGDAAGPAAGAPPTGAGVRHRDAERSRTVLAFETLERIH
GATLGRAGDRPAPGALDAAAAYPPRGGEPVPLPAPPAPPMGETAALRARRSSFGRFDAGRAVTAEQLAAA
LAQCAATRPGSEAERSDGPPLTSLYVFVNHVEGIEPGSYAYDPAEHALRLVVPGPPGPFLQANYFLSNYN
LEQAGAVLVPTVRTSAVLDAVGDRGYRLMGAAVGAVAQTFYTTAAAHGLGAGVALGFDNVSYAERLGLAD
TDEAPLLIMLLGHERPRPADFRHEIA