Home 

Gene Symbol:  
SSNG_06379
Organism:  
Streptomyces sp. C
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
7107787..7109445 [-1], 1659 bp
Product Function:  
conserved hypothetical protein
Product Locus:  
 ZP_07290758.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1659 bp
>SSNG_06379|ThioFinder768 Streptomyces sp. C
CTGGAGCGGCGCTGGCAGGCGGTGCGGTCGGTCGCGCTGCGGGACGCCCTGGAGCTGGGCGGCGGTACCC
GGGCGGCGGGCGGCTGGCCGTACGCGCACGCCTTCGCCGCCGACGCGCTGGCCGCGCTGGTGGTCTCGGC
GGGCTCCGGCGCCGCCGGGGCGGCGGCCGGGGTGTTCCCCGGGGTGTGGGTGCTGGACCTGCGGAGCGGG
GGCGTGCGGCGCTACCCGCTGGTGCCCGACCCGGAGTGCCCGGTGTGCGGGACGCCCGAGGCGGACACGG
CCCGGGCGCTGGATCCGGAGCCGGCGCCCAAGTACCGGCCGGGGGCGTTCCGTACCCGGCCGGTGGAGGC
GTACGCCATCGACGTGGCGGCGTTCGCGAACCCGCTGTGCGGGGCGCTGGGGCCCTCGCTGGTGCAGGAC
GTCTCCTCGACGTCCACCTCGGCGACCATCGGGTGCTTCTCGATGCGGTCGGGCGAGTACCTGCGCGAGA
CGTTCTGGGGCGGGCACACCGACTCCTTCGACCGCAGCGCCCGCGTCGGGGTGCTGGAGGGGCTGGAGCG
GTACGCGGGGATGCGCTCGCGCTCGCGCACGACCAGCGTCACCGGCTCCCTGAACGGCTTCGGGGCCGAG
GCCGTCGACCCGCGGGTCGTGGGCCTGTACAGCGGGGCGTTCCACCGGGACAACCCCCGGGTGAGGCCCT
TCGACCCGGACCGGGAGATCCCCTGGGTGTGGGGGTGGTCGCTGCGCGACCGGGAACCGCGGCTGGTGCC
GGAGGTGCTGACGTACTACCACGCGCCGGGCCTGGAGAACCGGTTCGTGCAGGAGAGCTCCAACGGCTGC
GCCTCGGGCGGGAGTCTGGCCGAGGCCGCCTACTTCGGGCTGATGGAGGTGGTCGAGCGGGACGCCTTCC
TGCTCACCTGGTACGGGCGGCAGCCGCTGCCCGAGATCGACCCGGCCACCAGTTCCCGGGCCTCGACGCG
GGCGATGGTCGACCGGCTGGCCCTGTACGGGTACCGGGCGCGGTTCTTCGACACGCGGATCAGTTTCCCG
ATCCCGGTGGTGACGGCGGTCGCCGAGCGGTTCGACGGCGGCCCCGGCCGGATGTGCTTCGGGGCGGGCG
CCGGGCTGGACCCGGAGTCGGCGCTGGACTCGGCGCTGTGCGAGATCGCCACGGACGCGGTGAACCTGCC
CGGCCGCACCGCGCGGGACGAGGAGCGGCTGCGTGCGATGGCGGCCGACTTCGACCTGGTCACCGCGCTG
CACGACCACCCGCTGGTGTACGGGGTGCCGGAGATGGGCCGCCACGCGGACTTCTTGCTGCGCGGGCCCT
CGCGGGGTCCGCTGCGCCCGGTGTCCTCGCTGCTGGGCCCCGAGGGGGTGTCGGACGACGTGGCCGAGGA
CCTGGCGCGGTGCGTGGAGGCCGTCGCCGCCGGGGGGTTCGACGTGGTGGTGGTCGACCAGACCCTGCCG
GAGCAGCGGGCGCTGGGCCTGCACACCGTGAGCGTGCTGGTGCCGGGGCTGCTGCCGATCGACTTCGGCT
GGTCGAGGCAGCGCGCCCTGGGCATGCCGCGGATGCGCACCGCCCTGCGCGAGGCGGGGCTGCGCGGGCG
CGACCTGGAGCCGGCCGACCTCAACCCGGCCCCGCACCCCTTCCCCTGA
 Primer design

Protein Sequence:552 a.a.
>SSNG_06379|ThioFinder768 Streptomyces sp. C
MERRWQAVRSVALRDALELGGGTRAAGGWPYAHAFAADALAALVVSAGSGAAGAAAGVFPGVWVLDLRSG
GVRRYPLVPDPECPVCGTPEADTARALDPEPAPKYRPGAFRTRPVEAYAIDVAAFANPLCGALGPSLVQD
VSSTSTSATIGCFSMRSGEYLRETFWGGHTDSFDRSARVGVLEGLERYAGMRSRSRTTSVTGSLNGFGAE
AVDPRVVGLYSGAFHRDNPRVRPFDPDREIPWVWGWSLRDREPRLVPEVLTYYHAPGLENRFVQESSNGC
ASGGSLAEAAYFGLMEVVERDAFLLTWYGRQPLPEIDPATSSRASTRAMVDRLALYGYRARFFDTRISFP
IPVVTAVAERFDGGPGRMCFGAGAGLDPESALDSALCEIATDAVNLPGRTARDEERLRAMAADFDLVTAL
HDHPLVYGVPEMGRHADFLLRGPSRGPLRPVSSLLGPEGVSDDVAEDLARCVEAVAAGGFDVVVVDQTLP
EQRALGLHTVSVLVPGLLPIDFGWSRQRALGMPRMRTALREAGLRGRDLEPADLNPAPHPFP