Home 

Gene Symbol:  
SSNG_06380
Organism:  
Streptomyces sp. C
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
7110372..7111907 [-1], 1536 bp
Product Function:  
predicted protein
Product Locus:  
 ZP_07290759.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1536 bp
>SSNG_06380|ThioFinder769 Streptomyces sp. C
ATGTCCCTGGACAGCTATCAGTACGTTGCCGCGACACGCCCCAGGATCCGCCGGGACGTGCTCTTCACCG
AGACGCCCGACGGCGTGCTGTTCCACAATTCCGACGGGGGCTTCCGCCTCACCGCCCGCACCGCCTACCG
GTTCGCCACGCTGATCGTCCCGCACCTGACCGGTGAGCACACCGTCACCGAGCTGTGCCAGGGCCTGGGC
GACACCCAGCGCGCCATGGTCGGCGAACTCGTCAAGACCCTGTACGAAAGGGACTTCGCCCGTTCCGTCG
CCGAGCCCGCCGACGCCGGCCGGGCCGCCGCACCGCCCCCGGACGTGGCCCGCAGATTCGCGCCGCAGAT
CGCCTACGCCGACCACTACGCCGATGACGCCGAAGCCCGCTTCCTGCGCTTCCGCGACACCCGGGTCGCC
GTCCTCGGCGAGGACGCGGTGGCCCGCTGGTGCGCGCTGAGCCTGGTGCGCAACGGCTGCGCCACCGTCG
GCGTGCTGCCCGGAGCCGACGCGGAGGAGGTACGGGCCGAGGCGGCCGAGGCCGTCGCCGACGGCTGCCC
GGTGGAGGTCCGCACCCTGCCCGGACACCCGCTCGGCTGGGACGGGTTGGCGGAGTACGAGTTCGTCGTG
GTGACCGGCGGGGCGGCGGCCCCGGCCCGGCTGCTGCCGCTGCTGCGCGCCGGGATCCCCGAGGGGCGCA
CCCTGCTGCCCGCCTGGTCGTACGGGAACGACGCGGTGGTCGGCCCGCTCATGGCGCACGGCACCGCCGG
CTGCTGGTCCTGCGCGGCCCTGCGGCTGGGCTCGGCGCGCGGCGGCCCGGCCGCGGCCGCGCTGTGGAGC
GCCCTCGCGCTGCCGGAGGCGCCCCTCGCCGAGGGCCCGGTGCCGGGGCGGCCGCTGTCCGCGATGATCG
GCAACCTGCTGGGGTACGAGGTGTTCCGCGCGGCTTCCGGTTCGCTGCCCGCCGAGACCGCCGGACGGCT
CCTCGTCCAGGACACGGCCTCGCTGGACGTCACCGCCGAGCCGCTCCTGCCGCACCCGCGCTGCCCGTTC
TGCGCGCCCGGCGAGACGGAGGCCGCCCCCCTGGACCTCACCGCCGCCGGCACCTCGGGCACGCCCGCAC
TGCCGACGCTGGAGACCGCGCGGGAGGCGGACGCGCTGGTGGAGGAGCTGAACCGGCGCTCCGCCCTGGT
GCGCCCGTACGCGGGGGTGTTCACCCGGTACGCCGACGAGGAGCTCACCCAGATCCCGCTGAAGGCCGGG
GTGGTGGAGCTGGGCCTCTGTTTTTTTGCGGACCCGTACCGTCGCCGCGTTCGACGTCCACCACGTGGCG
GGGGCGCGGATGCGGGCCCTGGACGCGGCGGCGCTGGTGTACGCGGAGCACGTGGTGCCGGCCCGCGACG
TGACCGTCGGCGACGGGGCCCCGGGCACCGTCCCCGCGGCGGCGCTGGCGACGGCCTCCGGGATACCGGG
CGGGGCGTCCGCGTACCAGCCCGCGGTGTCCCTGCTGACGAAGGAGCCCGCGCTGGTCCCGGCGGG
 Primer design

Protein Sequence:511 a.a.
>SSNG_06380|ThioFinder769 Streptomyces sp. C
MSLDSYQYVAATRPRIRRDVLFTETPDGVLFHNSDGGFRLTARTAYRFATLIVPHLTGEHTVTELCQGLG
DTQRAMVGELVKTLYERDFARSVAEPADAGRAAAPPPDVARRFAPQIAYADHYADDAEARFLRFRDTRVA
VLGEDAVARWCALSLVRNGCATVGVLPGADAEEVRAEAAEAVADGCPVEVRTLPGHPLGWDGLAEYEFVV
VTGGAAAPARLLPLLRAGIPEGRTLLPAWSYGNDAVVGPLMAHGTAGCWSCAALRLGSARGGPAAAALWS
ALALPEAPLAEGPVPGRPLSAMIGNLLGYEVFRAASGSLPAETAGRLLVQDTASLDVTAEPLLPHPRCPF
CAPGETEAAPLDLTAAGTSGTPALPTLETAREADALVEELNRRSALVRPYAGVFTRYADEELTQIPLKAG
VVELGLCFFADPYRRRVRRPPRGGGADAGPGRGGAGVRGARGAGPRRDRRRRGPGHRPRGGAGDGLRDTG
RGVRVPARGVPADEGARAGPGG