Home 

Gene Symbol:  
SACT1_4712
Organism:  
Streptomyces griseus XylebKG-1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5376572..5377618 [1], 1047 bp
Product Function:  
putative lantibiotic biosynthesis protein
Product Locus:  
 ZP_08238120.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1047 bp
>SACT1_4712|ThioFinder792 Streptomyces griseus XylebKG-1
ATGACCCCCTCACCCGCACCGGCCGCGACCGCCGCCGGCACGTGGCAGGCCACCCACGTCTTCTACGCCG
CCAACCCCCGCCCCTTCCTCCTGAACTGTGTCCGCCCGCTGGTCGCGGAGCTGGAGGCCGACGGGCTGCT
CGCCGGGTACTTCTTCATCAACTACTGGCTGGAGGGCCCCCACGTACGGCTGCGCCTCAAGCCGTCCTCA
CCCGCCGCCGAGCCGGAGGTGGCCCGCCGCACCGAGGAGGCCGTGGACGCGTTCCTCGCCGAGCGGCCCG
CCCTGTACGAGGTCGACTCCGGGTTCCTCAACGACTTCTACAACACCCTCTTCGAGATCGAGTTCCCCGG
CGGCGAGCGCGGCCACTACACCGACGAACAGGGCCGGATGAACCTGCGCCCCAACAACTCCCGCCACCGC
GAGCCCTACGAACCGGAGTTCGGGAAGTACGGCGGTCCCGCCGGGATCGAGCTGGCCGAGTGGCACTTCC
GGCACTCCAGCGATCTGGTGATCGACGCGCTCGCCACCAAGAACCTCCACCTGCGCACCGTCCTGCTGGG
CACGGCCGCCCAGTTCATGATGGTGATGGCCGCCACCTTCCTGCCGGACCGGGCGGAGCTGACCGGATAC
CTCGACGACTACTACGCGTTCTGGCACCGGGCGTTCCCCGGCACCGGATTCATCGGCACCGACGAGTACG
ACACCAACTACGCCCGGACGGCGGACGGGCTGCGGGACCGGTTCGCCCGGGTCCGGGCCGCCACCGCCCC
GCCCGGGAGCGCCCGCTCGCTCCCCGGGTCCCTGGCCGGCTGGGCCGAGCACTGCGCCGAACTGCGCGAC
CGGGCCCGGGGGCTGGCCGTGGACGGAGACCTGGTCTTCCGGTCCTGGGACGGCGAGCGGGACGAACGGG
TCACCGACCCCGCCGTGGCGCTGCCGCTGCTGCTCTCCCCATACATGCACATGACGAACAACCGGCTGCA
CGTCACCATCCGCGACGAGGCCTATCTCAGCCACGTCCTGGGCCGGGTCCTCAAGGAGTCCGCGTGA
 Primer design

Protein Sequence:348 a.a.
>SACT1_4712|ThioFinder792 Streptomyces griseus XylebKG-1
MTPSPAPAATAAGTWQATHVFYAANPRPFLLNCVRPLVAELEADGLLAGYFFINYWLEGPHVRLRLKPSS
PAAEPEVARRTEEAVDAFLAERPALYEVDSGFLNDFYNTLFEIEFPGGERGHYTDEQGRMNLRPNNSRHR
EPYEPEFGKYGGPAGIELAEWHFRHSSDLVIDALATKNLHLRTVLLGTAAQFMMVMAATFLPDRAELTGY
LDDYYAFWHRAFPGTGFIGTDEYDTNYARTADGLRDRFARVRAATAPPGSARSLPGSLAGWAEHCAELRD
RARGLAVDGDLVFRSWDGERDERVTDPAVALPLLLSPYMHMTNNRLHVTIRDEAYLSHVLGRVLKESA