Home 

Gene Symbol:  
SACT1_4711
Organism:  
Streptomyces griseus XylebKG-1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5373753..5376572 [1], 2820 bp
Product Function:  
Lantibiotic dehydratase domain protein
Product Locus:  
 ZP_08238119.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2820 bp
>SACT1_4711|ThioFinder791 Streptomyces griseus XylebKG-1
ATGACCGAAACCACCGGGCCCGCCGGTACAGCCGCAACCACCGGGACCGCCGGTACCGCCGAAACCACGG
GGACCACCGGGACCGCCGACGCGGTCGACGCCGCTCGCAGCGGCACCGGCTCCCCCCGCCCCGCGTTCAT
GCTGCGCGTCGCCGGGCTCCCCGTCGACGACGTCCGGGCCCTGCGCTGCCCCGACAGCCGCCGCTGGGCC
GACGACGTCCTCGACACCACCGAGCAACTGGCGCTGCTGGCCGGCAAGGCCGGGGACCAGCTGCACGGGC
TGATCGGCGGCAGCGACGACGAACCGCTGCGCCGCGCCCTGCTGAAGCTGCGCCGGGACGTCTTCAACAA
CCGGCTGCCGGACCCGGTGGCCGCCGAGGACGCCCTCGCCCGGGTGGGCGCCCTCGACCCGGCCGCCGCC
CGGGCCCTCGCCGACTGGCTGACCGGCCGCCGCGCCCTCGCCGGGAAGCGCGAGGCGGGGGCCGGGCCGC
TCGCCGCCGAGACCGGCCGCAGTCGCGCCGAACTGGCCCGGATCGCCGGCCACGAGCGCCTGCGCAAGGG
GCTGTTGCTCGCCTCGCCGACCCTGGACGCGCAGCTCGACGCCTACCGGCGCCAGGCGTCCCGGGCCGGG
GCCCGGCCCGACCGCAAACAGCGCAAGATCGAACGCTCGCTGCTCTCCTACGTCTACCGCACCGCCTGCA
AGACCAGCCCCTTCTCCACCTTCACCGCCGTCGCCCCCGGCGTGTTCGGCGGCTCGGACGGCCTGCGGGT
CCGGGTCGGCGAGGAGTGGCGGACGCAGGTCCGGCTCAACGTCGTGGCGCTCGGCCGGCTCGCCGACGCG
GTGATCGCCGACCCGGTCCGCCGGGCCGACCTGCCCCTCGCCCTCGCCTCCGGCTGGGGACGCGACGACG
ACCGGGTCCGCTACGTGCGGCGCTGGGTCACCGCCGGGGACGACGACACCGCCGTCACCTTCGACGCGGT
GAAGGACCGGCTGTTCTTCCTGCGCCGCAGCGGCACCCTGGAACGGCTGCTCGGCCTGTTCGAGGAGCGC
GGCACGATCCGCTACGGCGAGCTGGCGGCCTGGCTGGAGCAGGACCGGGGCGCGGCGCGCGAGGAGTGCG
AGCAGTACCTCGGGGCGCTCCTGGACGTCGGCATGGTCCAGGTGCCGTGCCTGCGGACCGAGGTCCACGA
CACCGACCCGCTCCGCGCCTTCCAGGACGCGCTGCGCGGCCTGGACCGCCCCTGGGCCGACCGGCTCGCG
GACCGGCTGGACGAACCCGCCGCCCAGGCCGCCCGCTTCGCCGAAGCGGCCCCGGACGAGCGGCGCGCCC
TGCTGGAGGCCGTGCGGGCCGGGCTGCGGGCCGTCCAGGAGGAGGAGCTGGGGGCCGGGCGCGCGAAGGT
GCCGCAGACCGTGCTGTACGAGGACGCGGCGGCGGCGCCCCGCCGGGCGACCGGCACCGGCGTCGCGCTG
GACCCCGAGGCCTGGGAGGAGCTGGCCGCCGGCCCGCTGGCGGCCGTGGAGCGGGTCCTGCCCGCCTTCG
ACCTCACCCTTCCGCAGCGGATCACCTTCCAGGGCTTCTTCCTCGCCCGGTACGGCCGCGGCGGGCGCTG
CGACGACCTGCTGAAGCTGGTCCACGACTTCCACGAGGACTTCTTCGACCAGTACATGACGTTCACCGCC
TCCCGCACCCCGTACGACGCCGACGGCGCCTACGTCCCCGAGGTCAACTGGCTGGGCCTGGAGCGGCTGC
GCGCCCTCGACACCGCCCGGCGCACCTTCACCGCCCGGATGACCGCGCTGTGGGAGGCGGCCGAAGCGGC
GGGACCCGGGGCGGCCGAGATACGTCTCGACGACGCGTTCCTCGACGCGGTCGCCGAAGAACTCCCCGCC
GTGGACGGCACCTTCACGCCGATGAGCCATCACGTGCAGATCGCCGACCGGCCCGGCGACCCGCTCGTCG
TCCTCAACCGCTCCTACGGCGGGGTGTCGTTCTCGTTCACCCGATTCACCCAGCTTTTCGACGGCCTCGG
CGAACGGCTCCTCGCCGACACCGACGCCCTGGTGCCCGAGGGCGCCGTCCTGGCCGAGGTCACCGGCGGT
CCCGTCACCAGCAACCTCAACCTGCACGCCAGGCTCACCCCGTACGAGATCGTCTGCCCCGGCGAACGCG
GCACCCTGGACGAGGAGTTCCGGATCGCACTGGACGACCTGTACCTCGTGCACGACCCGGAGGCCGACCG
GCTGGCCCTGCGCTCGGTCCGCCTGGACCGCGAGGTGATCCCCGTCTACCTCGGCTACCTCGTCCCCCTC
GCCCTGCCCGAACTGCCCCGCACCCTGCTCCTCCTCTCCCCGACCTCGATGGCCCCCCTCAACGTGTGGG
CGGGCGTCCCCGAGGGCGAGCCGCGCGGCGGGGTCACCGGGCGGCCCCGGGTGCGGCACGGCTCCCTCGT
CCTGAGCCGGCGCAGCTGGAGCGCCCCGGCGGCCGTCCTGCCGCTGCACCGGCCGGGCGCCCCGGAGGAC
GGCTGGTTCCTGGACTGGCACGCCTTCCGGCGCACCCACGGTCTGCCCGACCGGGTCTTCGCGACCGTGT
CGGACACCGGGGCCCGGGGCGCGACCGGGGCCAAACCGCAGTACCTCGACTTCGACAGCCCGCTGTCCCT
GTCCGCCTTCGAGGCGCTGGTCAAGTCCGCCGACGCCCGCGTGGTGTTCCGGGAGATGCTGCCCGACGAG
GACACGCTGCCCACCGTCAGCGGTCACGGCCGCCATGTCGCCGAACTGGCCGTGGAGACGGCCGTACCCG
TCCGCAGGAGGACCACCTGA
 Primer design

Protein Sequence:939 a.a.
>SACT1_4711|ThioFinder791 Streptomyces griseus XylebKG-1
MTETTGPAGTAATTGTAGTAETTGTTGTADAVDAARSGTGSPRPAFMLRVAGLPVDDVRALRCPDSRRWA
DDVLDTTEQLALLAGKAGDQLHGLIGGSDDEPLRRALLKLRRDVFNNRLPDPVAAEDALARVGALDPAAA
RALADWLTGRRALAGKREAGAGPLAAETGRSRAELARIAGHERLRKGLLLASPTLDAQLDAYRRQASRAG
ARPDRKQRKIERSLLSYVYRTACKTSPFSTFTAVAPGVFGGSDGLRVRVGEEWRTQVRLNVVALGRLADA
VIADPVRRADLPLALASGWGRDDDRVRYVRRWVTAGDDDTAVTFDAVKDRLFFLRRSGTLERLLGLFEER
GTIRYGELAAWLEQDRGAAREECEQYLGALLDVGMVQVPCLRTEVHDTDPLRAFQDALRGLDRPWADRLA
DRLDEPAAQAARFAEAAPDERRALLEAVRAGLRAVQEEELGAGRAKVPQTVLYEDAAAAPRRATGTGVAL
DPEAWEELAAGPLAAVERVLPAFDLTLPQRITFQGFFLARYGRGGRCDDLLKLVHDFHEDFFDQYMTFTA
SRTPYDADGAYVPEVNWLGLERLRALDTARRTFTARMTALWEAAEAAGPGAAEIRLDDAFLDAVAEELPA
VDGTFTPMSHHVQIADRPGDPLVVLNRSYGGVSFSFTRFTQLFDGLGERLLADTDALVPEGAVLAEVTGG
PVTSNLNLHARLTPYEIVCPGERGTLDEEFRIALDDLYLVHDPEADRLALRSVRLDREVIPVYLGYLVPL
ALPELPRTLLLLSPTSMAPLNVWAGVPEGEPRGGVTGRPRVRHGSLVLSRRSWSAPAAVLPLHRPGAPED
GWFLDWHAFRRTHGLPDRVFATVSDTGARGATGAKPQYLDFDSPLSLSAFEALVKSADARVVFREMLPDE
DTLPTVSGHGRHVAELAVETAVPVRRRTT