Home 

Gene Symbol:  
SACT1_4710
Organism:  
Streptomyces griseus XylebKG-1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5372152..5373738 [1], 1587 bp
Product Function:  
nitroreductase
Product Locus:  
 ZP_08238118.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1587 bp
>SACT1_4710|ThioFinder790 Streptomyces griseus XylebKG-1
ATGGGATACGCCCATGAATACGCCGACGCGATCATGCATCGCGGCCGGGTCCCGATGGACCCCGCGGACT
ACGTACCGAACTGGCAGGACGGCCCCCGCAAGGCCAAGTACCACCCGGGCGCGGACGGCTTCCCGCTGCC
GGACGCGTCCTACCCGGCCGGGGCGACGCTCGACCGGGGCCTGTTCCCCGAAGGCGGCCCGGCCGAGGGG
GAGTTCGACCTCGTCGCGCTCTCCGGCATGCTCCGCGACTCGTACGGTCTCACCGGCCGCCGCCTCGGCG
TCCAGGCCAACACCGACCTGGACGCCCTGCCCTTCTACCCGCTGGCCAACTGGTCGCGCGGCTCCGCCTC
CGGCGGCGGGCTGTACCCGGTCGGCATCCACTGGGTGTCCGGGCCGAGCGGCCCCGTGCCGCCCGGGGTG
CACTACTACTCCACCCGGCACCACTCCATGCAGCGGCTGCTCACCGGCGATGTCTCCGACCGGGTCCGCG
CGGCGCTGGGGGAGGACGCCCCGGGGCCGGAGACCGATCAGTACCTGGTGCTCTCCATCAAGTACTGGCA
GAACTCCTTCAAGTACAACAGCTTCTCCTTCCACGCCGTCTCCATGGACCTCGGGGCCTGCGTCCAGACC
TGGCGGATGTGGGCCGCCGCCCGGGGGCTGGCCGTCGAGCCGGCCCTCTGGTTCGACGAGGAACGCCTCG
CGGAACTCCTCGGGGTGGACCCCGAGGCGGAGGGGATCTTCGCGGTGGTCCCGCTCAAGTGGGCCGGTCC
GCAGCCGCCTTCGGGGCGGCCCGCCGCTGAGGGGCCCGTCGCCGTGCGCCGCGGGGACGTCGAGCGCTCC
CGGACCGTCCTCACCTTCGACGCGCTGGTCCGCATGCAGGCGGCCACATCGGCCGACGCCGCGGCCCGGC
CCGCCCCGGGGGCGCTGGCCCCGGCCGCCGCGCACCCCGTCGACCGGGCGCTCGCGGAGGTCGCGCTGCC
GCCCGCCCGGGCGCTGGACGCGGACGTACGCACCGCCCTGCGCGCGCGCCGCAGCAGCTTCGGCCGGTTC
GACGCCCAGCGGCCGGTCACCGCCGACCAGTTGGCCGCCTGCCTGGCCGCCGCCTCGGCCGGATCGCGGA
TCGGCGGCGACACCGGGGACGTCCGGCTGACCCGGCTCTACGCGTTCGTGAACCACGTCGAGGGCGTCGA
GCCCGGCTCGTACGCCTACGACCCCGAGCGGCGCGGTCTGCGGCGGGTGAAGGAGGGGCGGCCGGGGGAG
TTCCTCCAGCGGAACTACTTCCTCTCCAACTACAACCTGGAGCAGGCCGGAGCGGTCCTGGTGCCGACCG
TCCGCACCACCGCCGTCCTCGACGCGGTCGGGGACCGGGGATACCGGCTGGTCAACGCCACCATCGGGGC
CGTCGCCCAGTCCGTCTACACCGCCGCCGCGGCCATGGACCTGGGCTGCGGCGTCGCCCTCGGCTTCGAC
AACATTTCCTACATCGAGGAGCTGGGTCTCGAAGGGACGGGCGAGGCGCCCCTGCTGATCATGATGATCG
GCAACGAACGCCCCGCCCCCGCCGACTTCCGCTACGAGATCGCCTGA
 Primer design

Protein Sequence:528 a.a.
>SACT1_4710|ThioFinder790 Streptomyces griseus XylebKG-1
MGYAHEYADAIMHRGRVPMDPADYVPNWQDGPRKAKYHPGADGFPLPDASYPAGATLDRGLFPEGGPAEG
EFDLVALSGMLRDSYGLTGRRLGVQANTDLDALPFYPLANWSRGSASGGGLYPVGIHWVSGPSGPVPPGV
HYYSTRHHSMQRLLTGDVSDRVRAALGEDAPGPETDQYLVLSIKYWQNSFKYNSFSFHAVSMDLGACVQT
WRMWAAARGLAVEPALWFDEERLAELLGVDPEAEGIFAVVPLKWAGPQPPSGRPAAEGPVAVRRGDVERS
RTVLTFDALVRMQAATSADAAARPAPGALAPAAAHPVDRALAEVALPPARALDADVRTALRARRSSFGRF
DAQRPVTADQLAACLAAASAGSRIGGDTGDVRLTRLYAFVNHVEGVEPGSYAYDPERRGLRRVKEGRPGE
FLQRNYFLSNYNLEQAGAVLVPTVRTTAVLDAVGDRGYRLVNATIGAVAQSVYTAAAAMDLGCGVALGFD
NISYIEELGLEGTGEAPLLIMMIGNERPAPADFRYEIA