Home 

Gene Symbol:  
SACT1_4709
Organism:  
Streptomyces griseus XylebKG-1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5370011..5372107 [1], 2097 bp
Product Function:  
biosynthesis docking scaffold protein, SagD family
Product Locus:  
 ZP_08238117.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2097 bp
>SACT1_4709|ThioFinder789 Streptomyces griseus XylebKG-1
ATGCCCGTTGAGACCGCGCCGGACACGGCGGCCCCCACGCCGGGCACGGCCCCCACGCCGGACGCCGCGG
GCACGGCGTACGCCCCGGTGGCTGCCGGTACCGCGCCGGGCGCGCCGGTGCTCGGGGAGTCCACCCGGCT
GCTCGCACGGCTGCTGGGGGAGGCCCTCGCCCGTCACGGCCGCGCGGCGGCCACCACCCCGCTGGACGTC
CGGCCCCTGGGCGTCCGCGACGCGTTCGCGACGGAAGGGCCGGCGGACGGAGCGGTGGAGTGGCCCGCGG
ACGGGCCGGTGGAGGGACCCGGGGGCCGGGCCGTCCCCGTGCGCTACTACGGGCGGCACGCCGTCGTCGG
TCCCCTCCCGGCCCCCGACGGCGCCCCCCGACGCCCCTGCGCCCGCTGCCTGGAGCGCCGGTGGCAGGGC
GTGCGGTCCGTCGCCCTGCGCGAGGCGCTGGAGCTCGGTTCCGGGACCCGGGCGGCGGGCCCGTCCCCCT
ACCTCACCCCCTTCGCGGCCGAGGCCCTCGCCGGAGTCGTCGCCGCCCGGCTGGACGGCGGCGGACCGGT
CACCGGCGCGTTCCCGGCCGTCCACCTCGTCGACCTCGACACCCTGGCCGTACGCCACTACCCGCTCGTC
CCCGACCCGGAGTGCCCCGCCTGCGGGCAGCCCGAACCGGACAGCGACGAGGCGGCCGCCCTCACCCTGC
GGCCCGCGCCCAAGCTGCGGCCCGGTGGCTTCCGGGTGCGGGACATCGAGGAGTACGAGCTGCCCGTCGA
GCCGTACGCCAACCCCGTGTGCGGCTCCCTCGGCCCCTCCGTCGTCCAGGACGTCTCCTCCACGTCCACC
TCCGCCACCATCGGCTGCTTCTCCATGCGCTCGGGACCGTATCTGCGCGAGACGTTCTGGGGCGGGCACG
CCGACACGTTCGCCGAGAGCGTCCGCATCGGGGTGCTGGAGGGACTGGAGCGGTACGCGGGCATGCGGTC
CCGCGCCAAACGCGCCCAGGTGCACGCCAGTCTGCACGCGCTGCGCGCCGAGGGCCGGGCCGTCGTGGAC
CCCCGCGTCAGCGGCCTGTACTCCGACGCCTTCCACCGGGCCAACCCCCGCGTCCGGCCCTTCACCCCCG
ACCGGGAGATCCCCTGGGTGCGCGGCTGGTCGCTCCGCGACTCCCGCACCGTCCTGGTCCCCGAAGTGCT
CACCTACTACCACGCGCCGGGCCTGGAGAACCGGTTCGTGCAGGAGAGCTCCAACGGCTGCGCCTCCGGG
GGAGCGCTGGAGGAGGCGGCCTACTTCGGGCTGATGGAGATCGTCGAACGGGACGCGTTCCTGCTCTCCT
GGTACGGGCGGGCCGCGCTGCCCGAGATCGACCCGCGCACCAGCCGCCGCCGCGCCACCCGGGAGATGGT
GGACCGGCTGGAGATGTACGGGTACGAGGCGCGGTTCTTCGACACCCGGATCTCCTTCCCGATCCCCGTC
GTCACCGGCGTCGCCGTCCGTCCCGACGGCGGACGGGGCCGGATGTGCTTCGGGGCGGGCGCCGGACTCG
ACCCGGAGGCGGCCCTCGCCGGGGCGCTCTGCGAGATCGCCACCGACGCCGTCAACCTCCAGGGCCGCAC
CGAGCGGGACGAGGAGCGGCTGCGGGCCATGGCGACAGACTTCGCGAAGGTCGAGGCGCTGCACGACCAC
CCGCTGGCGTACGGGATCCCGGAGATGGGCGACCACGCGGAGTTCCTGCTCGGCGCGCCGGGCAGCCCCC
GACCGCCGCTGCGCTCCTTCGACGACCTGTACGGGGACGGGCCCGACGCGCGGCCGGTGCTCCCGGTCTC
CGACGATCTGCTCGAGGACCTGCTGCGGTGCGTGGACACCGTCGCCGCCGCCGGGTTCGACGTGGTCGTC
GTCGACCAGACCATGCCGGAACAGCGTGACCTGGGGCTGCGGACGGTGAGCGTGATCGTGCCCGGACTGC
TCCCGATCGACTTCGGCTGGACCCGCCAGCGCGCCCTGCGGATGCCCCGGCTGCGCACCGCCCTGCGCGA
GGCGGGCCTGCGGACGGCGGACCTCACCGACGCCGACCTCAACCCGGCCCCGCACCCGTTCCCATGA
 Primer design

Protein Sequence:698 a.a.
>SACT1_4709|ThioFinder789 Streptomyces griseus XylebKG-1
MPVETAPDTAAPTPGTAPTPDAAGTAYAPVAAGTAPGAPVLGESTRLLARLLGEALARHGRAAATTPLDV
RPLGVRDAFATEGPADGAVEWPADGPVEGPGGRAVPVRYYGRHAVVGPLPAPDGAPRRPCARCLERRWQG
VRSVALREALELGSGTRAAGPSPYLTPFAAEALAGVVAARLDGGGPVTGAFPAVHLVDLDTLAVRHYPLV
PDPECPACGQPEPDSDEAAALTLRPAPKLRPGGFRVRDIEEYELPVEPYANPVCGSLGPSVVQDVSSTST
SATIGCFSMRSGPYLRETFWGGHADTFAESVRIGVLEGLERYAGMRSRAKRAQVHASLHALRAEGRAVVD
PRVSGLYSDAFHRANPRVRPFTPDREIPWVRGWSLRDSRTVLVPEVLTYYHAPGLENRFVQESSNGCASG
GALEEAAYFGLMEIVERDAFLLSWYGRAALPEIDPRTSRRRATREMVDRLEMYGYEARFFDTRISFPIPV
VTGVAVRPDGGRGRMCFGAGAGLDPEAALAGALCEIATDAVNLQGRTERDEERLRAMATDFAKVEALHDH
PLAYGIPEMGDHAEFLLGAPGSPRPPLRSFDDLYGDGPDARPVLPVSDDLLEDLLRCVDTVAAAGFDVVV
VDQTMPEQRDLGLRTVSVIVPGLLPIDFGWTRQRALRMPRLRTALREAGLRTADLTDADLNPAPHPFP