Home 

Gene Symbol:  
SACT1_4708
Organism:  
Streptomyces griseus XylebKG-1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5367688..5370021 [1], 2334 bp
Product Function:  
YcaO-domain protein
Product Locus:  
 ZP_08238116.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2334 bp
>SACT1_4708|ThioFinder788 Streptomyces griseus XylebKG-1
ATGGCCGAGAGCGCCGCACCCACCGCACCCGCCACGCCCCCCTCGACGACCGCACCCGGGTCGTCCCCCG
CGTCCCCCGCGTCCCCCGCGTCCGGCGCGTTCGACGCGCTCGCCGGGACCCGGCCGCGCGTCCGGCGCGA
CGTGCTGTTCACCGAGACCCCCGGCGGAGTGCTGTTCCACAACGCCGACGGCGGTTTCCACCTCACCGGC
CGCACCGCCTACCGCTTCGCCTCCCTCGTCGTCCCGCACCTCACCGGGCGCCACCGGCTGGCCGAACTCT
GCGCCGGATTCGGGCCCGCGCAGCGGGCGATGGCCGCCGAACTGGTCAAGACGCTGTACGCGCGCGGCTT
CGCCCGCGACATCCCCGAGGCCGACCCCGCCGGAGACGCCCTCGACGAGGAGACCGCGGAGCGGTTCGCG
GCGCAGATCGCCTACGTCGACCACTACGCCGACGACGCCCCCGCCCGCTTCGCCCGCTACCGGGCCACCC
GCGTCGCCGTCCTCGGCGACGACGAGACGGCCCGCTGGTGCGCGCTGAGCCTGGTGCGCAACGGCTGCGC
GGACATCGGCACCGTCACGGCGGCGGAGGGCACGGCCGCCCCGCGGGACGACGCGCCCCCGCAGGACGGG
GCCGCCGCGCCGGACGTCGCCGCCGAGGCCGCCGCCCACGGGACGCGCATCGGGACGATCACCGCCGGGA
CGGACGCGGGCTGGGCCGACCTGGACGGCTACGACGTCGTCGTGGTCACCGGCGCGGACGCCGGGGCGCG
CACCCACCGGCTGCTGGCCGCCGGGGTGCCCGAGGGCGTGACCCTGATCCCCGCCTGGCCGTTCGGCCGC
CGCCTGGTCGTCGGCCCGCTCGCCACGGCCCGCTCCACCGGCTGCTGGTCCTGCGCCCTGCTGCGGCTGG
GCGGCAACGTCGACCCCGGCACGGCCGCCGAGCTGTGGAGCGAGGCGGCCGGGGCCGTACCCGCCGCCGG
GGCGGCCCTGTCCGGTCCGGTCGCCGCGATGGTCGGCAACCTCGTCGGCTACGAGGTCTTCCGCCTGGCC
ACCGGCGCGCTGCCCGCCGAGACGGCCGGCCGGCTCCTCGTCCAGGACCTGGAATCGCTGGACGTGATGG
CCGAACCGGTCCAGCCCCACCCCCGGTGCGCCCGCTGCACCCTGCTCGCCGCCGGCGAACCCGCGGGAGA
GTCCGCCGCCGAACCCGCCGCGCTGCCCGGCCCGCTCGCGCTGCCCGTCACCGCGACCGTGGAGACCGCC
CGCGACGCGGAGGAGCTGGTCGAGGAGCTGAACCGGATCAGCACCGCGCTGGTCCGCCCGTACACGGGGA
TCTTCCGCCGGTACGACGACGAGGAGCTGACCCAGACCCCGTTGAAGCTCAGCCGGGTCGAGGTGGCGCT
CGGCGGCGGGAGGAGCCGCCGCATCGCCGCGTTCGACGTGCACCACCTGGCCGGGGCGCGGACGCGGGCG
CTGTACGCGGCGGCCGAGGCGTACGTCGAGCACGTGGTCCCCCTGACGGGGGTGGAGAGCGGCGGGCCGG
ACGGCGGTGCGCGGACGCTCGGGCCCGACGCCCTGACGACCGGCGGCGGCACCGGGGCCGTCCCCGCAGC
CTGGGCGGTCGCCACCTCGCTGATCGGCAAGGACCCGGTCCGTGTCCCGGCCGCCGCACTGCGCCCGTTC
GGGCCGCACAACCACGACCGGGCGCACCTGGCGACCACCGCCGGCTCCGGAGCGGGCGGCAGCGCGGCGG
AGGCGGCGGGCCGGGGGCTGCTGTCCGCCCTCGCCCACGACGCCCTGCTCCGCGCGGTGCGGGGCGCCAC
CCGGGTCGGCCCGCTGGCGGTGGGCGGCGACGATCCGGAGCTGGTGTTCCTGCTGAAGTCCGCCGCCAAC
CTGGACATCGCGGTGGACCTCCTCGACCTGGGCGAGGCGGACCGCACCACCGCGCACGTGGTGCTCGCCC
GGGAAGTGAACGGGCCCTCCGCCGCGCCCCGTTGGGCGGTCGGCGCGGGGCTGTCCGGGCGGGCGGCGGC
GGCGTCCGCCCTGCGCGACCTGCTCGGTCAGGCGCAGCTCGCGGCCGAGGACCCGGGGGAGGCGGTCGAC
ACCGGGGACCCGCTGGTGGTCGACCTGGCCCCCGGGGCGATCGCGGTGGGCGGCGGGTCCGTCGCGGCGG
ACGCGGCGGAGACCACGTTCGACGCGGTGCTGGAGGCCCTGAGGTCCGCCGGCCGCGACGCCCTGTACGT
GCCGACGACCCCGGCGGACCTGCGCTCCGGCTCCATCGCCACGGCCCGGGTGCTGCTCACGGTGGACGGC
GAGGTCGGCACCGATGCCCGTTGA
 Primer design

Protein Sequence:777 a.a.
>SACT1_4708|ThioFinder788 Streptomyces griseus XylebKG-1
MAESAAPTAPATPPSTTAPGSSPASPASPASGAFDALAGTRPRVRRDVLFTETPGGVLFHNADGGFHLTG
RTAYRFASLVVPHLTGRHRLAELCAGFGPAQRAMAAELVKTLYARGFARDIPEADPAGDALDEETAERFA
AQIAYVDHYADDAPARFARYRATRVAVLGDDETARWCALSLVRNGCADIGTVTAAEGTAAPRDDAPPQDG
AAAPDVAAEAAAHGTRIGTITAGTDAGWADLDGYDVVVVTGADAGARTHRLLAAGVPEGVTLIPAWPFGR
RLVVGPLATARSTGCWSCALLRLGGNVDPGTAAELWSEAAGAVPAAGAALSGPVAAMVGNLVGYEVFRLA
TGALPAETAGRLLVQDLESLDVMAEPVQPHPRCARCTLLAAGEPAGESAAEPAALPGPLALPVTATVETA
RDAEELVEELNRISTALVRPYTGIFRRYDDEELTQTPLKLSRVEVALGGGRSRRIAAFDVHHLAGARTRA
LYAAAEAYVEHVVPLTGVESGGPDGGARTLGPDALTTGGGTGAVPAAWAVATSLIGKDPVRVPAAALRPF
GPHNHDRAHLATTAGSGAGGSAAEAAGRGLLSALAHDALLRAVRGATRVGPLAVGGDDPELVFLLKSAAN
LDIAVDLLDLGEADRTTAHVVLAREVNGPSAAPRWAVGAGLSGRAAAASALRDLLGQAQLAAEDPGEAVD
TGDPLVVDLAPGAIAVGGGSVAADAAETTFDAVLEALRSAGRDALYVPTTPADLRSGSIATARVLLTVDG
EVGTDAR