Home 

Gene Symbol:  
SSHG_03899
Organism:  
Streptomyces albus J1074
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4447482..4448549 [1], 1068 bp
Product Function:  
lantibiotic biosynthesis protein
Product Locus:  
 ZP_06592996.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1068 bp
>SSHG_03899|ThioFinder1067 Streptomyces albus J1074
ATGACCGACCTGACCCTCACCGGCACCCGGGCCGCCACCAAGTCCGGCGCCTGGCAGGCCACCCACGTCT
TCTACGCCGCCAACCCCCGCCCGTTCCTGCTCACCTGCGTGCGCCCGCTCGTCGCCGAGCTGGAGGCACA
GGGGCTGATCAGCGGCTACTTCTTCATCAACTACTGGCTGGAGGGCCCGCACGTCCGGCTCCGCCTCAAG
CCCGCCACCCCCCAGGCGGAGGCCGAGGTCCGCCGCCGCACCGAGGAGGCCGTCGACACCTTCCTGCGCG
AACGCCCCGCGCTCTACGAGGTGGACGCCGGCTTCCTCAACGACTTCTACAACACCCTCTTCGACATCGA
GTTCCCCGGCGCCGAACGCGGCCACTACACCGGCGCCGACGGCCGGATGAACATCCGCCCCAACAACAGC
CGCAGCGCCGAACCGTACGAACCCGAGTACGGCAAGTACGGCGGGCCCGCCGGGATCGAGCTGGCCGAGT
GGCACTTCCGGCACTCCTCCGACCTGGTCATCGACGCCTTCGCCACCATCAACCTCCACCTGCGCACCGT
GCTGCTCGGCACCTCCGCCCAGCTGATGATGGTGATGGCCGCGACCTTCCTCCCGGACAAGGCCGAACTC
AACGGCTACCTCGACAGCTACTACGAGTTCTGGCACCGCGCCTTCCCCGGCACCAACTTCATCGGCACCG
ACGAGTACGACCGCAACTACGCCGCCCTCGCCCCCGGCCTGGGGGAGCGCTTCGCCCGCGTCCGCGCCGC
CACCGACCCCGCCACCGAGGAGGCCGACAAGCCCCGGCTGCCCGGCTTCCTCGCGGGCTGGGCCGAGCAC
TGCGCCGAACTCAGGGAGAAGGCGGAGAGGCTGACGCTCGACGGGGACCTGGTCTTCCGCTCCTGGGACG
GCACCCGGGACGAGCAGGTCACCGACCCGGCCGTCGCACTGCCGCTGCTGCTCTCCCCGTACATGCACAT
GACCAACAACCGGCTGCACGTCACCATCCGCGACGAGGCGTACCTCTCGCACGTGCTGGGCCGGGTGCTG
CGCGAGGGCGCCGCGTGA
 Primer design

Protein Sequence:355 a.a.
>SSHG_03899|ThioFinder1067 Streptomyces albus J1074
MTDLTLTGTRAATKSGAWQATHVFYAANPRPFLLTCVRPLVAELEAQGLISGYFFINYWLEGPHVRLRLK
PATPQAEAEVRRRTEEAVDTFLRERPALYEVDAGFLNDFYNTLFDIEFPGAERGHYTGADGRMNIRPNNS
RSAEPYEPEYGKYGGPAGIELAEWHFRHSSDLVIDAFATINLHLRTVLLGTSAQLMMVMAATFLPDKAEL
NGYLDSYYEFWHRAFPGTNFIGTDEYDRNYAALAPGLGERFARVRAATDPATEEADKPRLPGFLAGWAEH
CAELREKAERLTLDGDLVFRSWDGTRDEQVTDPAVALPLLLSPYMHMTNNRLHVTIRDEAYLSHVLGRVL
REGAA