Home 

Gene Symbol:  
SSHG_03898
Organism:  
Streptomyces albus J1074
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4445322..4447485 [1], 2164 bp
Product Function:  
lantibiotic dehydratase domain-containing
Product Locus:  
 ZP_06592995.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2164 bp
>SSHG_03898|ThioFinder1066 Streptomyces albus J1074
CGAACGGTCGCTGCTGTCCTACCTGTACCGGACCGCCTGCAAGACGAGCCCCTTCTCCACCTTCACCGGG
GTCGGGCTCGGCACCTTCACCGACGGGGAGCCGCACGCGGGCCCCGGCGCCTTCCCGCTGGCCGTCGCCG
ACGCCTGGCCGACCGCCGCCCGGCTCAACACCGCCGCCGTCGGCCGGCTCGCCGCCACCGTCCTGGCCGA
CCCGGGCCGCCGCGCCGACCTGCCCGTCACCGTCGCCTCCGGGTGGGGGCGCGAGGCCGACCGGGTGCGG
TACGTGCGGCGCTGGGTCACCGAGGGCGACGAGGCCACCGCCGTCACCTTCGACTCCGTCAAGGACCGCC
TCTTCTACCTCCGCCGCAGCGGCACCCTCGACCGCCTCCTCGGCCACTTCGAGGAGCACGGCACCCTGCG
GTACGGCGCCCTCTCCGCCTGGCTCGCCGCCGACCGGGACGCCACCGAGGCCGACGTCGCCCAGTACCTG
GACGCGCTGCTCGCCCTCGGCCTGGTCCGGGTGCCCTGCCTCGACGTCACCGTCCACGACACCGACCCGC
TGCGCGCCTTCCAGTCGGCCCTGCGCGGGGTGGGCCGCCCGTGGGCCGACCGCCTCGCCGACCGGCTGGA
GCCCGCCGCGGCCTGCGTCGACAAGTTCGCCGCCGCCGAACCGGACCGCAGGCGGCTCCTCCTGGAACAG
CTGAGGGGCGAACTCGCCGCCGTGCAGCGGTCGCTCGGCGCCGAGCAGCACCGCGTCCCGCAGACCGTGC
TCTACGAGGACTGCGCGGTCCCGGCCGACGGGCCCACCGGCCTCACCCTCTCCGCCGACCGCTGGGCCGA
GGTGGCCGGGGAGCCGCTCTCCCGGCTGGAGCGGGTGCTGCCCGCCTTCGACCTGACCCTGCCGCACCGG
CTTACCTTCAAGGGGTTCTTCACCGCCCGGTTCGGGCGCGGCGGGCGCTGCGACGACCTGGTCAAGCTGG
TCCACGACTTCCACGAGGACTTCTTCGACCAGTACCTCTCCTTCACCGCCCAGCGCCCCGCCTTCGGCCC
CGACGGCGACCCCAACCCCGAGGAGAACTGGCTCGGCCTGCCCGAGCTGAAGTCCCTGGACGCCGCCCGC
GCCACCTTCCTGGCCGGGATGCGGGAACGCTGGGGCGCCCACGAGGGCGACGGCGACCTCGTCCTCGACG
ACGCCCTCCTCGACGCCACCGCCGCCCCGCTCGCCCCCCTCGCGCCCGCCTTCGCTCCGATGAGCCACCA
CGTCCAGCTCGCCGACCGCCCCGAAGGCCCGCTCGCCGTCCTCAACCGCTCCTACGGCGGCCTCTCCTTC
CCCTTCAGCCGCTTCACCCACCTCTTCGAGGGCCTGGACGAGCGGCTGCTCGCCGCCGGGGCCCAGGCCG
CGCCGCCCGGCGCCGTCCTCGCCGAGGTCACCGGCGGCCCCGTCACCTCCAACCTCAACCTGCACGCCCG
CCTCACCGAGTACGAGATCGTCGGCCCCGGCGAGGCCGGCACCCTGGAGCCGGAGTTCCGGCTCGGCCTG
GACGACCTCTTCCTCGTCCACGACGAGGAGCAGGACCGCCTCGTCCTGCGCTCCGCCCGCCTGGAGCGCG
AGGTGATCCCGGTCTACCTCGGCTACCTCGTCCCGCTCGCCCTGCCCGAACTCCCGCGCACCCTGCTGCT
GCTCTCCCCGACCTCCATGTCCCCGCTCAACGTCTGGGGCGGCGTCCCCGACCGCCCGCCCGTCGACGGG
GTCACCCACCGGCCCCGGGTCCGCCACGGCAGCCTGGTCCTCGCCCGCCGCAGCTGGGGCGTGGACGCCC
GCGACCTGCCGTTGCGCGCGCCCGGCACCGACGAGGCCGCCTGGTTCCTCGGCTGGCACCGCTTCCGCCG
GGCCCACGGCCTGCCCGCGAGGGTCTACGCCACCGTCTCCGACAGCGGGGCGCGCGGCGCGACCGGCGCC
AAGCCGAGCTACCTCGACCTCGACAGCCCGCTCTCGCTCGCCGCCTTCGAGGCGCTGCTCCGTACCGACA
AGGCCCGCGCCGTCTTCCGTGAGGCGCTGCCCGACGAGGACGGGCTGCACGCCGCCTCGCCGCGCGGCCG
GCACGTCACCGAACTGGCCGTGGAGACCCTGCCCGCCCCGACCCCCGCGAGGACCGCGCCATGA
 Primer design

Protein Sequence:720.33333333333 a.a.
>SSHG_03898|ThioFinder1066 Streptomyces albus J1074
ERSLLSYLYRTACKTSPFSTFTGVGLGTFTDGEPHAGPGAFPLAVADAWPTAARLNTAAVGRLAATVLAD
PGRRADLPVTVASGWGREADRVRYVRRWVTEGDEATAVTFDSVKDRLFYLRRSGTLDRLLGHFEEHGTLR
YGALSAWLAADRDATEADVAQYLDALLALGLVRVPCLDVTVHDTDPLRAFQSALRGVGRPWADRLADRLE
PAAACVDKFAAAEPDRRRLLLEQLRGELAAVQRSLGAEQHRVPQTVLYEDCAVPADGPTGLTLSADRWAE
VAGEPLSRLERVLPAFDLTLPHRLTFKGFFTARFGRGGRCDDLVKLVHDFHEDFFDQYLSFTAQRPAFGP
DGDPNPEENWLGLPELKSLDAARATFLAGMRERWGAHEGDGDLVLDDALLDATAAPLAPLAPAFAPMSHH
VQLADRPEGPLAVLNRSYGGLSFPFSRFTHLFEGLDERLLAAGAQAAPPGAVLAEVTGGPVTSNLNLHAR
LTEYEIVGPGEAGTLEPEFRLGLDDLFLVHDEEQDRLVLRSARLEREVIPVYLGYLVPLALPELPRTLLL
LSPTSMSPLNVWGGVPDRPPVDGVTHRPRVRHGSLVLARRSWGVDARDLPLRAPGTDEAAWFLGWHRFRR
AHGLPARVYATVSDSGARGATGAKPSYLDLDSPLSLAAFEALLRTDKARAVFREALPDEDGLHAASPRGR
HVTELAVETLPAPTPARTAP