Home 

Gene Symbol:  
SSHG_03897
Organism:  
Streptomyces albus J1074
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4443148..4444117 [1], 970 bp
Product Function:  
conserved hypothetical protein
Product Locus:  
 ZP_06592994.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:970 bp
>SSHG_03897|ThioFinder1065 Streptomyces albus J1074
GTGGGGTACGCCTACGACTACGCCGCCGCCATCATGCGGCGCGGCCGGGTCCACATGGAGCCGGTCGACC
ACGTGCCGAACTGGGCCGACGGCCCGCGCAAGACCAAGCACTACCCGGACACCGACCTGCTGCCGCTGCC
CGACTCCGGTTACCCGGCGGACGCCGCCCTCGACCAGGGCCTGAACCCCGAACCCCTCGACGGGCCGGGC
CACTTCGACCTCGCCGCGCTCTCCGGGATGCTCCGCGACTCCTACGGCCTGACCGGCCGCCGCCTCGGCG
TCCAGGCCAACACCGACCTCGACGCGCTCCCGCACTACCCGCTCGCCAACTTCTCCCGCGGCTCGGCCTC
CGGCGGCGGCCTCTACCCGGTCAGCGTCTACTGGGTCTCCGGCCCCTCCGCGCCCCTGCCGCCCGGCGTC
CACCACTACGCCACCCGCCACCACGCCATGCGCCGCCTGCTCACCGGCGACGCCACCGGCGAGGTCCGTG
CCGCCCTGGAGGCCGCCGGGCCGGGCGCGCCGGACGGGGCCGACGCCACCGACCAGTACCTGGTCCTCTC
CATCAAGTACTGGCAGAACGCCTTCAAGTACAACAGCTTCTCCTTCCACGCCGTCTCCATGGACCTCGGT
GCCTGCGTGCAGACCTGGCGGCTGTGGGCCCGGGCGCGCGGGCTCGACGTGGAGCCCGCGCTCTGGTTCG
ACGAGGAGCGCCTCGCGCGGCTGCTCGGGGTGCGGACCGAGGAGGAGGGGATCTTCGCCGTGGTGCCGTT
GCGGTGGCAGGGGGCCACCGGGGCCGCCGCGGCCCCGGCCACCCCGTTCGCCGTGCGCCACCGGGACGTG
GAGCGCTCCCGCACCGTCCTCACCTTCGAGGCCGTCACCGCCATGCAGGCCGCCACCGCCGAAGGCGCTC
TCGACCGGCCCGCCCCCGGCGCCCTCGCCCCGGCCGCCGCCCACCCGGCCGGCCCGGCCC
 Primer design

Protein Sequence:322.33333333333 a.a.
>SSHG_03897|ThioFinder1065 Streptomyces albus J1074
MGYAYDYAAAIMRRGRVHMEPVDHVPNWADGPRKTKHYPDTDLLPLPDSGYPADAALDQGLNPEPLDGPG
HFDLAALSGMLRDSYGLTGRRLGVQANTDLDALPHYPLANFSRGSASGGGLYPVSVYWVSGPSAPLPPGV
HHYATRHHAMRRLLTGDATGEVRAALEAAGPGAPDGADATDQYLVLSIKYWQNAFKYNSFSFHAVSMDLG
ACVQTWRLWARARGLDVEPALWFDEERLARLLGVRTEEEGIFAVVPLRWQGATGAAAAPATPFAVRHRDV
ERSRTVLTFEAVTAMQAATAEGALDRPAPGALAPAAAHPAGPA