Home 

Gene Symbol:  
SSHG_03896
Organism:  
Streptomyces albus J1074
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4441224..4443095 [1], 1872 bp
Product Function:  
conserved hypothetical protein
Product Locus:  
 ZP_06592993.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1872 bp
>SSHG_03896|ThioFinder1064 Streptomyces albus J1074
CTGCACCGGGCGCTGGCCGCCCACGCCACGCCCGTCCCCCTCGACCTCGCCCCGCTCGGCGTCCACGACG
CCTTCCGGGCGCCGCTCGCCGCGTCCGAGGCGGGGGCCGTGCCGGTACGGCTCTACGGGCGGCAGGCCGT
GGTCGGGCCCTTCCCCGGGGAGCGGGAGCAGCCCTGCGCCCGCTGCCTGGAGCGGCGGTGGCAGGCGGTG
CGCAGTGTGACGCTGCGGGAGGCGCTGGAGCTGGGGTCCGGGACGCGGGCGGCGGGGGAGAACCCGTACC
TGACGGTGTTCGGGGCCGAGGCGGTGGCCGGGCTGATCGCGGCCCGGCTCGGCGGGCGCGGACCGGAGAC
GGGGGCGTTCGCCGCCGTGCACCTGGTCGACCTCCAGACGCTGCGGACCCGGCACTACCCGCTCGTCCCC
GACCCGGAGTGCCCGCGCTGCTCGGTCGCCGAGGAGGACACCGCCGAGGCCGCCACGCTCACCCTGGGGC
CCGCGCCCAAGCACCGGCCCGGCAGCTTCCGCGTCCGCGACCTCGCCACCTACGAGCTGCCGATCCAGCC
GTACGCCAACCCGCTCTGCGGCTCGCTCGGGCCCTCCGTCGTGCAGGACGTCTCCTCCGGGTCGACCTCC
GCCACGGTGGGCTGCTTCTCGATGCGCTCCGGCGACTACCTCCGCGAGACCTTCTGGGGCGGCCACGCCG
ACACCTTCGGGCAGAGCCTGCGCATCGGCGTCCTGGAGGGCCTGGAGCGGTACGCCGGGATGCGGTCGCG
GGCGAAGAAGGCCGAGGTCCGGGCCTCGCTCGACCAGCTCGTGGCGCGCGGGGAGCAGGTGGTGGACCCG
CGCGTGGTGGGGCTGTACGACGAGGCGTTCCACGCCGCCAACCCGCACGTGCCGCCCTTCACCACCGGCC
GCGAGATCCCCTGGGTGTGGGGGTACTCGCTGCGCGACGAACGCCCCGTCCTCGTCCCCGAGGTGCTCAC
CTACTACCACGCCCCCGGGCTGGAGAACCGGTTCGTCCAGGAGTCCTCCAACGGCTGCGCCACCGGCGGC
TGCCTGGAGGAGGCCGTCTACTGCGGGCTCATGGAGGTCGTCGAGCGGGACGCCTTCCTGCTCGCCTGGT
ACGGGCGGGCCGCCCTGCCCGAGATCGACCCCGCGACCAGCACCAGCGCCGCCACCCGGCACATGGTCGA
CCGGCTCGCGATGTACGGCTACGAGGCCCGGTTCTTCGACACCCGGATCACCTTCCCGATCCCGGTCGTC
ACCGGCGTCGCCGTCCGCCCCGACGGCGGGCCGGGCCGGATGTGCTTCGGCGCGGGGGCCGGGCTCGACC
CCGAGGCGGCCGTCGCGGGCGCCCTCTGCGAGATCGCCACCGACGCCGTCAACCTGCCCGGCCGCACCCG
GCGCGACGAGGCCCGGCTGCGCGCCATGGCCACCGACTTCCACCGCGTCGAGGCGCTCCACGACCACCCG
CTCGCCTACGGCATCCCCGAGATGGGCGACCACGCCGACTTCCTCCTCGGCGCCCCCGGCACCCCGCGCC
CGCCGAAGCGCTCCGTCGCCGAGCTGTACGGCGACGGCTCGCTGCCGCCCGTCTCCGACGACCTGCGGGA
CGACCTCGCCCGGTGCGTGGACGCCGTCACCGGCGCCGGCTTCGACGTGGTCGTCGTCGACCAGACCATG
CCCGAACAGCGGGCGCTGGGCCTGAGGACCGTCAGCGTCCTCGTCCCCGGCCTGCTCCCCATCGACTTCG
GCTGGACCCGCCAGCGCGCCCTCGGCATGCCCCGCCTGCGCACCGCCCTGCGCGAGGCGGGCCTCGCCGG
CCGCGACCTCACCGACGCCGACCTCAACCCCGCCCCGCACCCCTTCCCCTGA
 Primer design

Protein Sequence:623 a.a.
>SSHG_03896|ThioFinder1064 Streptomyces albus J1074
MHRALAAHATPVPLDLAPLGVHDAFRAPLAASEAGAVPVRLYGRQAVVGPFPGEREQPCARCLERRWQAV
RSVTLREALELGSGTRAAGENPYLTVFGAEAVAGLIAARLGGRGPETGAFAAVHLVDLQTLRTRHYPLVP
DPECPRCSVAEEDTAEAATLTLGPAPKHRPGSFRVRDLATYELPIQPYANPLCGSLGPSVVQDVSSGSTS
ATVGCFSMRSGDYLRETFWGGHADTFGQSLRIGVLEGLERYAGMRSRAKKAEVRASLDQLVARGEQVVDP
RVVGLYDEAFHAANPHVPPFTTGREIPWVWGYSLRDERPVLVPEVLTYYHAPGLENRFVQESSNGCATGG
CLEEAVYCGLMEVVERDAFLLAWYGRAALPEIDPATSTSAATRHMVDRLAMYGYEARFFDTRITFPIPVV
TGVAVRPDGGPGRMCFGAGAGLDPEAAVAGALCEIATDAVNLPGRTRRDEARLRAMATDFHRVEALHDHP
LAYGIPEMGDHADFLLGAPGTPRPPKRSVAELYGDGSLPPVSDDLRDDLARCVDAVTGAGFDVVVVDQTM
PEQRALGLRTVSVLVPGLLPIDFGWTRQRALGMPRLRTALREAGLAGRDLTDADLNPAPHPFP