Home 

Gene Symbol:  
SSHG_03895
Organism:  
Streptomyces albus J1074
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4437052..4440297 [1], 3246 bp
Product Function:  
transcriptional activator protein
Product Locus:  
 ZP_06592992.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:3246 bp
>SSHG_03895|ThioFinder1063 Streptomyces albus J1074
ATGCGGTTCCAGCTGCTCGGCCCGCTCTCGCTGCACGACGGCCCCGAGTCGGTCGTCCTCCAGCCCGCCA
AGCCCACCGTCCTGCTGACCGCGCTGCTCCTGCACGCCAACTCCGTGGTCTCCGCCGACTACCTCCAGCG
GGCCATCTGGGGGGAGGAGCAGCCGGCCACCGCCAAGGCCGCCCTCCAGACCTGTGTCCTCAGGCTCCGG
CGGCTCTTCACCAAGCACGGGGTCACCGAGACACCGATCGAGGCCGTCCCCGGCGGCTACCGCATCACCG
CCGGTCCGCACACCCTGGACCTCATCGGGTTCCGGGAGCGGGTCCGGCGGGCCGCCGCCCTCACCCACGA
CCCGCAGGCCGAACTGGCCGCCCTGCGCGACGCGCTGGCGCTCTGGCAGGGCCCGCTCCTCGCCAACGTC
CGCTCCGACCTGCTCCACCGCGACGAGGTGCCCCGCCTCGCCGAGGAACGGCTGCGCGCCGTGGAACGGC
TCTGCGGCCTCCACCTGCGGCTCGGGCGGTGCGGGGAGGCGCTGGGCGACCTGTGGGAGGTGACCCGCGC
CCACCCCGGCCACGAGCGGTTCCACGAGCAGCTGGTCGAGGCGCTGTACCGGACCGGCCGCCAGGCCGAG
GCGCTCGCCGAGTACCGGCGCGTCAAGGAGTACCTGCTCCAGGAACTCGGGGTCGACCCGGGCGCCGCCC
TCCAGCGGCTCGAACTGGCGATCCTGCGCGGCGACACCCTCGACGCCGGGCCCGCCGGGGAGGAGGACGG
CCGCCCGGCCGCGCTCCCGGAGGCGCCCGCCGCGCCCGGGCCCGAGGAGCCCGGCCTGGTCACCGCGCTC
ACCCCGGTCCCCGACTTCACCGGGCGCGCCGCCGAGGTGGCCGCGCTCACCTCCCACCTCACCGCCGACA
CCGCCCACCGGCCCGGCGGCCCGCTGACCGTCGTCCTCTCCGGCGCCCCCGGCATCGGCAAGTCGGCGCT
GGCCCGGCACGTCGCCACCCAGCTCGCCGACCGCTTCCCCGGCGGCCGGCTGCTGATCCGCCTGACCGGC
CCGGACGGGCGTCCCCACGACCCGCAGACCGTCGCCGGACAGCTCACCCGCGCCCTGGCGGACCGCCCGC
CCGGCAGCCCCACCCTGCTGGTCCTGGACGACGCGGCCGGCGCCGACCAGGTACGGCCGCTGCTCGCCGC
CTGTACCGGCGGGGCCGTCGTGGTCACCAGCCGGCGCGGCCTCGCCGGGCTGGTCGCCACCCACGGCGGG
CGCGTGGTGCGGCTCGGGCCGTTCCGCCCGGCCGAGTCGCACGCCCTGCTCCGCTCCGTCCTCGGCGCCG
AACGCGTCGACGCCGAACCGGACGAGGCCCGCCGGATCGCCGAGGGCTGCGGCCACCACCCGCTGGCCCT
GCGCATCATGACGGCCCGGCTGCTGACCCGCCCCGGGCTCGGCCTCGCCGACTCCGCCCGCTGGCTCGGC
CCCGACCAGGCCGGACGGCTCGCCCTCACCGACGCCCCCGGGCTCTCCGTGCCCGAGGTGCTGGGGGAGG
CGCTGGCCCGGCTCGACCCCCCGCTCGCCGACGCCTTCCCGCGGGTCGCCGCGCTCGGGCCGGCCTGCGG
GGCCGAGGAGGTCTTCACCCAGACCCCCGGCGGGGTCCTCTTCCACAACGCCGACGGCGGCTTCCACCTC
ACAGGGCGCACCGCCTACCGGTTCGCCGCCCTCGTCCTGCCGCACCTGACCGGGCGCCACCGGCTCGACG
AGGTGTGCGCCGGGTTCGGCCCGGCCCAGCGGGCGATGGCCGCCGAACTGGTCCGCACCCTCTACGCCCG
CGACTTCGCCCGCGACATCCCCGAGGCCGACGCGCTGAGACCGGCGCCGGAGGACGCCGCAGGACAGCGG
TTCGCCGCGCAGATCGCCTACATCGACCACTACACCGACGCGGCCCCCGACCGGTTCGCCCGCTACCGGG
CCGCCCGCGTCGCCGTCCTCGGCACCGACGAGACCGCCCGCTGGGTCGCCCTCGGCCTGGTCCGCAACGG
CTGCGGAACGGTCGGGCTGGCCGCCGACTTCCCCGACGTGACCGGTGAGGCCGCCCAACTCGCCGAAGAG
GGCTGCCCGGTGAGCCTGAACCGGCTGCCCGACCCCGCCGAGGGGCCCGGCTGGGCGGCGCTGGACGGGT
ACGAGGTCGTCGTGGTCACCGGACCCGGCGCGGCCGGGCTCACCCACCGCCTGCTCACCGAGGGCGTCCC
CGAGGGCCGCACCCTGCTGCCGGCCTGGGCCTTCGGCGAGCGGCTGGTCATGGGCCCGCTCACCACCGGC
GCCGACGCCGCGAGCGCCACCGGCGGCTGCTGGTCCTGCGCCCTGCTCCGCCTCGGCGCGAACGTCGACG
CGGGCACCGCCGCCGCCCTGTGGAGCGAGGTGGCGGGCGGCGCCCGGAGCCTGGACGCGGGCGCGCCGGG
GCCGCTGACCGGGCCGGTCGCCGCGATGGCCGGCAACCTCCTCGCGTACGAGGTGTTCCGGCTGACCAGC
GGGGTGCAGCCGGCCGAGACGCGCGGGCAGGTGCTCATCCAGGACCTCTCCTCGCTGGACGTCCTCGCCG
AACCCGTGCCCCCGCACCCGCGCTGCCGCCACTGCGCCCCCTCCGGAGTCCCGGTGACCTCGCCCGGGAC
CCCGGAGGTCCCCCGTACGCCGAGTGTGGCCGGGGCCGAGGAGGCCCAGGAGGTGGTGGACGCGCTCAAC
GCCACCGCGAGCGCGCTGGTCCGCCCGCACACCGGGGTCTTCACCCGCTTCGACGACGACGACCTCACCC
AGACCCCGCTCAAGGTCAGCCGCGTCGAACTCGCCCTGCCCGACGGCACGGTGCGCGCCGTGACCGCCGC
CGACATCCACCACCTCGCCGGGGCCCGGACCCGCGCCCTGCACCGGGCCGCCGTCTTGTACGTCGACCAC
ACCGTGCCGGCGCCGACGGCGGGGGAGGAACACGGCGCACCCGTCGCACCGGCCTCCCTCGCCACCTTCG
GCGGGGCCGACGCCACCCCGGCCACCGCCTGGACCCCCGCGCTCTCGCTGCGTACCGGTGAGCCGCACCG
CGTGCCCGTCCCGGCCGCCCGGCCCTTCGGCCCGCACAACCGGCTCCGGACGCACCTGGCCGCCACCGCC
GGTGCGGGCGCCGGGGGTTCGGCCGCCGAGGCGGCCGGGGCCGCGCTGCTCGCCGCCCTCGCCCACACCG
CCGTGCTGGACGCCGTCCGGGGCAGG
 Primer design

Protein Sequence:1081 a.a.
>SSHG_03895|ThioFinder1063 Streptomyces albus J1074
MRFQLLGPLSLHDGPESVVLQPAKPTVLLTALLLHANSVVSADYLQRAIWGEEQPATAKAALQTCVLRLR
RLFTKHGVTETPIEAVPGGYRITAGPHTLDLIGFRERVRRAAALTHDPQAELAALRDALALWQGPLLANV
RSDLLHRDEVPRLAEERLRAVERLCGLHLRLGRCGEALGDLWEVTRAHPGHERFHEQLVEALYRTGRQAE
ALAEYRRVKEYLLQELGVDPGAALQRLELAILRGDTLDAGPAGEEDGRPAALPEAPAAPGPEEPGLVTAL
TPVPDFTGRAAEVAALTSHLTADTAHRPGGPLTVVLSGAPGIGKSALARHVATQLADRFPGGRLLIRLTG
PDGRPHDPQTVAGQLTRALADRPPGSPTLLVLDDAAGADQVRPLLAACTGGAVVVTSRRGLAGLVATHGG
RVVRLGPFRPAESHALLRSVLGAERVDAEPDEARRIAEGCGHHPLALRIMTARLLTRPGLGLADSARWLG
PDQAGRLALTDAPGLSVPEVLGEALARLDPPLADAFPRVAALGPACGAEEVFTQTPGGVLFHNADGGFHL
TGRTAYRFAALVLPHLTGRHRLDEVCAGFGPAQRAMAAELVRTLYARDFARDIPEADALRPAPEDAAGQR
FAAQIAYIDHYTDAAPDRFARYRAARVAVLGTDETARWVALGLVRNGCGTVGLAADFPDVTGEAAQLAEE
GCPVSLNRLPDPAEGPGWAALDGYEVVVVTGPGAAGLTHRLLTEGVPEGRTLLPAWAFGERLVMGPLTTG
ADAASATGGCWSCALLRLGANVDAGTAAALWSEVAGGARSLDAGAPGPLTGPVAAMAGNLLAYEVFRLTS
GVQPAETRGQVLIQDLSSLDVLAEPVPPHPRCRHCAPSGVPVTSPGTPEVPRTPSVAGAEEAQEVVDALN
ATASALVRPHTGVFTRFDDDDLTQTPLKVSRVELALPDGTVRAVTAADIHHLAGARTRALHRAAVLYVDH
TVPAPTAGEEHGAPVAPASLATFGGADATPATAWTPALSLRTGEPHRVPVPAARPFGPHNRLRTHLAATA
GAGAGGSAAEAAGAALLAALAHTAVLDAVRGR