Home 

Gene Symbol:  
HMPREF0514_11732
Organism:  
Lactobacillus gasseri JV-V03
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
15623..16465 [1], 843 bp
Product Function:  
lantibiotic biosynthesis protein
Product Locus:  
 ZP_07058975.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:843 bp
>HMPREF0514_11732|ThioFinder953 Lactobacillus gasseri JV-V03
ATGATGAGTAAGATGGAATGGAAAGCTATACATATATTTTATTATGATAATCAAGATTATTTATTACTAA
AATTAATAAATAGTCTTGTGAAAAAATATAATATTCAGGATTTTTTCTTTATAAGATATTGGGAATCTGG
ACCGCATGTGAGATTTAGATTTAAATCGAAAAGAATTAAAGAGTTAGAAAGGGACATAGAAACATTTTTA
AGAGAGAATCCGTCTTCCCTAGAAATAAATAAGGATGATTTAATAAAAATTAATAAAGAATATTATCGTA
GGGAAAATATAAAAAAACATGAACCAGTGATGATTGCATCTAATAATAGTTTTAAAGAATTTAAATATTA
TCCTGAGTATAATAAATACTTTGGAAAAAATGGGGTTGAAATTGCAGAAGAAGAGTTTATTTTTAGTAGC
AAACTTGTACTAATATTATTGTCTATCAACAAAGATACTTCGTTTAAGATAGCCCTTGCATGTATTTTCT
TTAGAATACTTATAGATATTATATATACTAACGAAGATGCTAAAAAATTTTTGGAAATATATAGACAGTA
TTGGCTTCATTTTGAAAATTATAATAATCTAAAAATAGAACATGAAATAAACTTATTAGACAATATGCGG
ATTCCTCTAAATTCTGAAAATAAATTATTGTTTCTTTTTAAGAGACTAAAAGTTGAGGATTTTCATAAGA
CAATTTTTTTCAAAATGAATAAAAATCAAAGAGAGAAATATCTGTTTAATTTCCTACATTTGTTTAATAA
TAGACTAGGATTGACTCCAAAATATGAAATAATAGTTTCAACAATTGTGAAGAATTATTATGAAAGTATA
TAA
 Primer design

Protein Sequence:280 a.a.
>HMPREF0514_11732|ThioFinder953 Lactobacillus gasseri JV-V03
MMSKMEWKAIHIFYYDNQDYLLLKLINSLVKKYNIQDFFFIRYWESGPHVRFRFKSKRIKELERDIETFL
RENPSSLEINKDDLIKINKEYYRRENIKKHEPVMIASNNSFKEFKYYPEYNKYFGKNGVEIAEEEFIFSS
KLVLILLSINKDTSFKIALACIFFRILIDIIYTNEDAKKFLEIYRQYWLHFENYNNLKIEHEINLLDNMR
IPLNSENKLLFLFKRLKVEDFHKTIFFKMNKNQREKYLFNFLHLFNNRLGLTPKYEIIVSTIVKNYYESI