Home 

Gene Symbol:  
HMPREF0514_11731
Organism:  
Lactobacillus gasseri JV-V03
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
13099..15633 [1], 2535 bp
Product Function:  
lantibiotic dehydratase, superfamily protein
Product Locus:  
 ZP_07058974.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2535 bp
>HMPREF0514_11731|ThioFinder952 Lactobacillus gasseri JV-V03
ATGAACTATTTGTTCAATTTAAATGATTTTTATTTAAAATTAAACAAAATTAATAGAAAAGAATCAAAGT
TAGAAGATCATTTGATTAATTTAGATAAAGAATTATTTATTACTATTGGAAAATTACCACAAGTACATTA
TAAAAAAGCAATTAAAATTAAACAAAAAATAAAAAAGAAAAATATACAATCTTTAGATCAACGAGATCTC
TATATATTTCCAGATAAAGTAAAGAAAGATATTATTTCTTTACAAAGAGAATATATAAATGTTTTAAATG
AAAAAGAAAATTTGAAGCAGGAATATATTTTACAGCTACAACACGAAATTGCGATGCTAAAGATTAACTG
TAAGGATGATTTTTTTCTTAATGGGCTACTATTTTCTCTTGATGAATCAACTATTCAGGAAATTGTTAAA
TTTATCAAGAATGAAAGATTATCTGGTAAAAGTAGAAGAAAGATAAGTAAGACTCTTAAGAACTATATGA
ACAGAGCAACAATGAAGCCAAGTCCATTTAGTACTTTTGTCATGAATTCAATATATTTTAATAATATTAC
TTTTACTGATCTACTAAAACAGGATTTAAGTTTGGATAATAAAATACATGTTTATTTAAATGAAATGATC
ATTCAAGACATAATAAGTTTATTATCTGGGGATTATGAATTGATAAATCAACTTTATATAAAAATCAATC
CAACAATGATTGAATCTGAAAACTATTATAAATTTTATAATAATAAAAAGTCTTATTATAGAGAAGCCGA
AATTAAGCTTCAAAAAAACATTAAAATAGAGGTGATAATTAACTTTATAAAAGACTTAGCTGCAAATAAT
GTGAAAGTTTCAAAATTGATAAATATTATTTGTAATAGTAGATATAGTAAAATGTTTGAAACACAAAAAA
GTGTTTTCAACTTAATATTAAGATTAGTTAATATCGGACTATTAGAAACAAATTTAAATATATCGCAAAT
GGATTTTCATGCTTTAGAAAAAATTGTAAAACTGTTGAATTCAGTTAGCATATCAAAATATGATAAATTG
GCTAGTCATTTAAATCATATATATGAAAATCTAGTAAAGATCAATGACTCTAAATTAAATATTGAAAAAA
CACTGAAATATAAGAATAGTATATATAATGACATTAAAGTAATAGCGTTAAATTATAATTTAGAGAATTT
GTTAAAAATTAAATATAAGAATTTGTTATATGAAAATTATACTGATCCTTCGATTATTAGCAATGACAAT
TTAAATAATATTGACCTTAGAGTTGAAGATTTTGATAGTATATCAAAGCTGTATAAGATCTTTGATAATA
ATCTGGTTTCTCAAATTGAATATAGAGAATTTTTTAAAGATAAATTTGATATAAGGGAAAAAGTTAGATT
AGTTGATTTTTTTGCAGAAATTACAAAAATCAAAGCAAATGATAAAATGAGATTAATTTCGGGATGCAGA
GATTTACAGCAAATTCTGCGAATTAGAAAAGAGTTTTGTGATTTTTTAAAAGAAAATTTATTAAGTGAAA
AAGATATAGAAATACCAGATGACTTGCTAAACAGAATATGGAAAAAAGCGCCTAAAATAGTTAAATTGAA
AACGAATTATGGTGTTTATTTTCAGTTTGATGAAGAGCTTATAATTAATAGTATAGCCCCAGGGTACGGA
AGGCATTTTAGTAGATATCTGACTGATTTAAGTGAAGATGATAAAATTAAAGTTAAAAAAGCTATATTAG
ATTTTAACGATGCATTACGAATAAAAGGAAAATCTGTTTATGCAGATATAGGAACTACTTTGGGTTTCAA
CATTAATAAGCACGAATTAATATATGATGACGTCATAAGATATCCTAACTCTTATGTAAATCCTATAAAA
AATAGTATTGATCTAAGTAATTTATACGTAAAGTACGATGCTAAAAGACAGTCATTAAAAGTAATTAATA
GTGATGATACTGAGATAAAAATAGTTCCTTTGGGATTTCAATTTTATAGAGCGGCTCCTAACTTATATAA
ATTTCTTTCAATACTGTCTAATACTCAGGGAATAAGGTTATCCTTGTGGGATGTGTTTTTTGAGCTCCAA
AAAGAAAAAGAAGACATATATCATTTTCCTAGAATTATCTATAAAAACATAGTAATTGAAAGAGAAACGT
GGAAAATACCATTAAAAGAAGTTAGAGATAGGCTGAGTAATTCTAATTTCGACAATTATGCAGAAATGAT
TAAATTTTTTGATAAAAATAATATACCTTTAAACTTTTTTGCCAAATTTTTTCCTCAATTAGACGTATTT
CTTAATTACAGAAACAAGCAATTGAAAAATCTAGAGTATAGTTTAACAACAACTAATTTTAGAAAGCCTC
AGTTTTATGATCTCCAAAGTGTATTAGATTTTTTGAATATTAGCAATATAATTCGAAAATGTAAATTTAG
CTATTTTACTATTCAAGAATGTCTACCAAAAAAGAAAAAAGATAAAACTATTCGAGAGTATTTAATTGAA
ATCAATGATGAGTAA
 Primer design

Protein Sequence:844 a.a.
>HMPREF0514_11731|ThioFinder952 Lactobacillus gasseri JV-V03
MNYLFNLNDFYLKLNKINRKESKLEDHLINLDKELFITIGKLPQVHYKKAIKIKQKIKKKNIQSLDQRDL
YIFPDKVKKDIISLQREYINVLNEKENLKQEYILQLQHEIAMLKINCKDDFFLNGLLFSLDESTIQEIVK
FIKNERLSGKSRRKISKTLKNYMNRATMKPSPFSTFVMNSIYFNNITFTDLLKQDLSLDNKIHVYLNEMI
IQDIISLLSGDYELINQLYIKINPTMIESENYYKFYNNKKSYYREAEIKLQKNIKIEVIINFIKDLAANN
VKVSKLINIICNSRYSKMFETQKSVFNLILRLVNIGLLETNLNISQMDFHALEKIVKLLNSVSISKYDKL
ASHLNHIYENLVKINDSKLNIEKTLKYKNSIYNDIKVIALNYNLENLLKIKYKNLLYENYTDPSIISNDN
LNNIDLRVEDFDSISKLYKIFDNNLVSQIEYREFFKDKFDIREKVRLVDFFAEITKIKANDKMRLISGCR
DLQQILRIRKEFCDFLKENLLSEKDIEIPDDLLNRIWKKAPKIVKLKTNYGVYFQFDEELIINSIAPGYG
RHFSRYLTDLSEDDKIKVKKAILDFNDALRIKGKSVYADIGTTLGFNINKHELIYDDVIRYPNSYVNPIK
NSIDLSNLYVKYDAKRQSLKVINSDDTEIKIVPLGFQFYRAAPNLYKFLSILSNTQGIRLSLWDVFFELQ
KEKEDIYHFPRIIYKNIVIERETWKIPLKEVRDRLSNSNFDNYAEMIKFFDKNNIPLNFFAKFFPQLDVF
LNYRNKQLKNLEYSLTTTNFRKPQFYDLQSVLDFLNISNIIRKCKFSYFTIQECLPKKKKDKTIREYLIE
INDE