Home 

Gene Symbol:  
HMPREF0514_11730
Organism:  
Lactobacillus gasseri JV-V03
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
11273..13030 [1], 1758 bp
Product Function:  
conserved hypothetical protein
Product Locus:  
 ZP_07058973.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1758 bp
>HMPREF0514_11730|ThioFinder951 Lactobacillus gasseri JV-V03
ATGAAAAAAATAACATCAACTAATCAAAAAATTATTATTGATCTTTTTAATAAAATACTTATTAGTTACA
TACCAAAAAATGCTTTATTAAAATGCTGTAGATTTTGCATTTTTAGAAGATTTATTAATACGCGAAAAGA
TAGAAAAATAATCAAAAATATTAGTTATAAGGAAATAGATTCATCTTCTATATTTTCTTCCATAGTTAAC
GAACTAATAAATTATTTAAAAAATGATAAACAACTAGTTGATGATAAATTTAGAAGAAAAGTATTTATAG
TAGATAAAAAAACGCTGAGTATAGATGTCTCTTATTGTTTAGCTGTACCCGATTGTCCATTTTGCTCTAC
TTTACCTAAAGATTCTATGAATTTAGCAGAAAAAAATGGAAAGTGTATTTTAAATAATCTTAATCAAGCA
GGAATGCCTTATAGATTTCGAAGTTCAAGATACTGGGATAAAATATTAGAAAATACAGTTTTAGATAAAA
ATCTAGGAATTATAACTACATTGTTAGATTATAAAGAAAAATATTTTAATAATGCTGTTGCTATACTTCC
TTTGTTAGATGGTAGAGATGAACCAGGAACAGGTAGAACGGGAAGATTAGAAAGTAGTAGAGGAATAGCC
TTATTGGAAGCAATGGAAAGATATGCAGGCTTTTATCCAAAAGGTAAAGAAACTACTGTTTATGAAAGTT
ATAATCAGCTACTTAAAAAAGTATCAAAAAAACATATTCTTTCAATTGATAAGTATATTTTAAATCAAGA
TTCTATTATTCCTAAAAAATCGAATATTTTTAATTTTGATAAAAAACAAAAATATCATTGGATTTGGGGA
TATGATATTGTGAATAGATGTCCAAGACTCATTCCTGAGACGTTAGCATATTATGGTATGACTTTAAAAA
ATTCAACTTATAAAAAGGAAATTATCGCTTACGAGATCTCAAATGGTTGTTCAACAGGATCTAGTTTATT
AGAAGCCTCATATTATAGTTTGCTAGAAGTTATTGAAAGAGATAGTTTTTTAACATATTGGTATATGCCA
CATCGGATTGATAAGATAGATATTATTAATTTAAAGGATAAAAAATTACAATCTGATATAAATATTTTTT
TTGAAGAGTATCCTGATTTTGCGCTATCATTTTATAATATTTCTAATGATACTAGAGTACCTGTAATACT
TTGCACTATAAAGCGAAAAAAAGTTAAAAAAGATAAAATGAATTTTATGTGTGCAGCTTCGGCAAATTTC
AATGTGTATAAAGCTATGTTTAATTCATTACATGAAATAACTAGTATATTTAATGGGCTTCAAAAGAAGT
TCACAAGTAATATAAACTCTATCAAAGCCAAATACACTAATTTAAACAACATAGAAAAGATGGAAGATCA
TAGTTTAGCATACGGATATTATCAAAATCTAAAATATATAAATTTTGAAAACAATGTAGCAAGAATGGTA
ACTCCAGAAGCATTGACAACAAAATTAGATGAAGAAGGATTATGTCAACAATTTAAATTTATTATAAATA
CATTTCGAAAGCAAAATCGAGAAGTTATTATAGTTGATCAGACAACGGAAGAAATGAATAAGATAAATTT
GTTTTGTACCAAAGTATTAGTGTCAGGATTACTTCCAATGACTTTTGGAGCGAAAAATGCAAGAATTTCA
AATTTAAGAAAAGAAGATATAACTAACTATTTTAAAGAAAATATTACAGTTAAATATTTACCGCATCCTT
TTCCTTAA
 Primer design

Protein Sequence:585 a.a.
>HMPREF0514_11730|ThioFinder951 Lactobacillus gasseri JV-V03
MKKITSTNQKIIIDLFNKILISYIPKNALLKCCRFCIFRRFINTRKDRKIIKNISYKEIDSSSIFSSIVN
ELINYLKNDKQLVDDKFRRKVFIVDKKTLSIDVSYCLAVPDCPFCSTLPKDSMNLAEKNGKCILNNLNQA
GMPYRFRSSRYWDKILENTVLDKNLGIITTLLDYKEKYFNNAVAILPLLDGRDEPGTGRTGRLESSRGIA
LLEAMERYAGFYPKGKETTVYESYNQLLKKVSKKHILSIDKYILNQDSIIPKKSNIFNFDKKQKYHWIWG
YDIVNRCPRLIPETLAYYGMTLKNSTYKKEIIAYEISNGCSTGSSLLEASYYSLLEVIERDSFLTYWYMP
HRIDKIDIINLKDKKLQSDINIFFEEYPDFALSFYNISNDTRVPVILCTIKRKKVKKDKMNFMCAASANF
NVYKAMFNSLHEITSIFNGLQKKFTSNINSIKAKYTNLNNIEKMEDHSLAYGYYQNLKYINFENNVARMV
TPEALTTKLDEEGLCQQFKFIINTFRKQNREVIIVDQTTEEMNKINLFCTKVLVSGLLPMTFGAKNARIS
NLRKEDITNYFKENITVKYLPHPFP